-
~ No-one knows just what the future holds,
Face it with grace, fortune favours the bold. ~
Lucky Star, Lord Blackmore and Deathwatch arrived in the new RP, fresh for adventure and ready for a new beginning.
"Here we are," said Lucky, smiling, "Pastures new!"
"Indeed, my boy," grinned Blackmore, stroking his chin in thought. Deathwatch said nothing, just nodded in agreement by his master's side.
Lucky glanced upwards at a familiar blue nebula in the sky - the Lucky Cosmos, his own place in the world of RPM. He watched as a small glint, like a star, descended from the nebula and quickly appeared as the Starlight Days, his mobile base. He hopped on board the walking airship and stood at the bow, letting his scarf flutter in the gentle morning breeze.
"Well," he mused to himself with a proud and eager grin, thrusting his finger forward, "Let's get going! Adventure awaits!"
-
Meanwhile, just south of where Lucky Star and the gang arrived, Mirby stepped out from the chronospatial rift, or CSR as she liked to call it.
"So this is the place, Nova? Pretty barren... Meh, this will be suitable to my needs." She started laying a groundwork for the adventures that she knew would start in the coming days.
-
"Maybe we can find the kingdom of Clow around here" Nova joked, "Maybe I should stop reading all those artwork booklets."
Nova began working on improving his car, which had started to break down "This thing won't get far int he desert, useless piece of junk!" Nova kicked the car with such force it left a dent. "How about we just find somewhere to get some information on where in the hell we are." Nova suggested.
-
Mirby looked around and saw nothing. "Hmmm.... this is odd..." she muttered. "Hold on a sec." She opened a CSR and entered it and reappeared to the north.
"Hey, Lucky, you got a map? Nova and I are kinda lost in that wasteland to the south. I would just use a CSR but he wants a map, or at the very least some information. Think you can help?"
-
Spectro turned on with a whir, only to find that it (he?) was half-buried in a dune. He had no idea where he could have been, since he'd never been in a desert before (external temperature readings were in excess of 90 Fahrenheit).
Spectro struggled to get himself out of the sand, when he saw someone next to a car.
"Couldn't hurt my chances..." he said as he readied a flare. He aimed as high as he could and fired.
-
Suddenly, a bright flash appeared to the south.
"Nevermind, gotta go!" Mirby said hurriedly as she opened a CSR to where she thought the flash came from. She appeared next to a sand dune, which was shaking for some odd reason and making mumbling sounds.
"hlpmsmhwwndpndsrtdntknwhwthppndsnynthrcnnynhrm?" said the sand dune.
"Just a sec! Who is that?" Mirby asked.
"t'sm,spctr!Wh'stht?" the sand dune replied.
"It's Mirby. Hold on, I'll get you out of there in a jiffy!" Mirby summoned a mighty whirlwind using the power of the Torna Sigil, and blew the sand dune away. "Are you okay?" Mirby asked, concerned.
"I am now. Thanks!" replied Spectro.
"No problem! I've got to get back to Nova. Stay out of trouble now, you hear?" With that, Mirby vanished into a CSR and went to help out Nova once more.
-
(Question, where exactly is this new RP taking place? o3o)
-
(Still RPM)
-
Spectro examined his surroundings, trying to remember exactly how it was that he ended up here. He could see moderately sized machinery debris scattered about, and remembered that he was in some sort of structure in space. Everything after that, however, up until now, was a blank.
"Well, it's no use trying to recall what I probably won't remember," said Spectro, as he salvaged the singed machinery parts. "I should just find a place for repairs."
-
(MEANWHILE AT THE HALL OF JUSTICE!)
Mirby appeared where she left Nova. "Hmmmm.... where did he go? No matter... I need to find some food." She used the Torna Sigil to levitate high in the air and scout out her surroundings. Grasslands to the north, the ocean to the west, volcanoes and calderas far to the south, and a city to the east. She summoned a CSR below her and fell in.
She reappeared in the midst of the city. She looked around and saw a repair shop with a sandwich shop right next door. "Hmmm.... I hope they have turkey and potato bread. Or at the very least, pomato bread... and lettuce..." Suddenly, she started drooling... Her eyes gained a bit of a sparkle... "I NEED THAT SANDWICH!" She broke into a sprint and ran into the sandwich shop and ordered.
"Welcome to Goto's, how can I help you?"
Mirby looked at the menu and saw the pomato bread. "I'll have turkey on pomato bread with lettuce, bacon, avocado..."
~A FEW MINUTES LATER~
"Thank you for eating at Goto's. Please come again!"
Mirby took her sandwich and sat down to eat. As she was about to take her first bite, a familiar sand-covered robot walked by outside...
-
After walking some distance, Spectro happened upon a city, and found a repair shop right next to a sandwich shop. As he was about to enter, Spectro made eye contact with a familiar face in the sandwich shop: the one who pulled him from the sand dune. He waved and continued into the repair shop.
-
"I wonder if she forgot me..." Nova said,sand burning up on him as it tried to smack his eyes
"I'll go on my own then!" Nova said, grumbling as he plodded onto who knows where.
-
((I dont know where to land. Hmm.))
-
[Sounds like your going to crash land somewhere.]
Nova sighed, finding it meaningless to cover his tracks, not like anyone was interested in him.
Which reminded him, he should really find where exactly Mirby was going to take him, before she dissapeared.
"If I could teleport magically then I wouldn't spend my time with you" Said one part of him
"You do know that your talking about hating yourself"
"And I do"
"I really need therapy.."
-
On a tall mountain somewhere, a lone figure stared down at the world below, their majestic cape billowing behind them. Calmly, he stuck his hands into his pockets.
So, I've finally arrived... He thought while a grin spread across his face.
Turning, his cape blew even more in the wind and he disappeared.
-
"Ahhh... that was delicious. Goto's really does make some great sammiches... Next time I'll try the Great Sandvich they have." Mirby said, exiting the shop. "Now to find Nova." She opened up a CSR and entered it, expecting to reappear in the desert. When she stepped out, she fell ten feet onto the top of a mountain. "What the? Oh no, he's here... The one who can disrupt my abilities... this... this is not good." She looked around to locate where she was. All she saw was a small piece of fabric, torn from his cape. "He's near... I have to get out of here!" She opened up a CSR and fell out of the other side right on top of Nova...
-
Nova walked casually as Mirby fell on top of him, he stumbled back as she fell right on top of him.
"Yow! Your not heavy, but when you land on top of me, it kinda hurts! You might have burned up if I was in Star form!"
Nova said, struggling to get out of Mirby and her weight, coughing up sand.
-
"Like I meant to! He's here! I don't know how he found me, but he did. And my powers go haywire whenever he's near." Mirby said hurriedly.
"Who's here?" asked Nova.
"HE IS! I don't have time to explain! All I know is if he's here then I-"
"Who is he?" demanded Nova. "I can't help you... me... I can't help if you don't tell-" Suddenly a bright flash of light appeared in front of him. When he looked back, he was in a completely different place. He was in a meadow, somewhere far to the west, across the great ocean. The world in front of him shimmered and waved in a frightening manner... "Where did she go? For that matter, where am I?" He looked around, worried, lost, and confused.
Mirby fell from the sky yet again, onto the side of an extinct volcano. "What the? Where's Nova? Where am I? What... what happened?" She became worried, scared, and lost as well...
-
"Mi-Mirby?" Nova said, worried of "His" power.
"Might was well find Mirby before "He" found either of them without the other, Nova is sure lost without her, literally.
He ran as fast as he could to the meadow, to a castle, a castle for who? He was going to find out!
-
So this is the RPM I've heard so much about, although, they don't seem all that strong. The man took on a thoughtful look as he looked around the peaceful city he'd arrived at. Although, from what I remember... He looked up, most of their power resides in space.
His thoughts were interrupted by a song - which was his ringtone. With a blink of surprise he pulled out his cellphone and answered it.
"It's me." He answered.
-
"Hmmm.... judging by the terrain, I must've warped far to the south somehow... but where did the bright flash of light come from? I hope that he didn't do it... no... couldn't have been. I defeated him, I know he's dead. He has to be! I sealed his body inside a neutron star! Wait... stop talking to yourself, Mirby... think this through..." She trudged on in silence down the mountain, her thoughts occupied, churning out many explanations as to his sudden unexpected reappearance...
-
Nova entered the halls of the castle, where everything looked like cardboard cutouts.
When he came up to the King, he started talking, a large blue rectangle with words came up on top of him. Nova cursed as he walked away from the castle, best to forget that whole episode.
-
Tai was taking out his Arcanince for a walk in the area with the extinct volcanoes when he suddenly saw Mirby fall from the sky.
"Oh, more people appearing out of nowhere." He then went to where Mirby landed to find out what was going on.
"Oh, hey it's Mirby. What brings you here?"
-
Mirby heard a familiar voice and turned around. "Oh, hey Tai. I wish I could tell you what brought me here... Truth is, I don't know. But I have a suspicion that it's because he has returned."
"Who?" asked Taiyo.
"He has. The one I sealed in the neutron star."
"Oh, crap. That's not good."
"No it is not. Also, I found this while walking; maybe you could use it." Mirby reached into her pockets and pulled out a reddish disc. "Maybe your Arcanine could use this."
"Thanks! Later!" said Taiyo, as he continued on his way.
"Now to find where Nova landed... I hope it's not too far away..."
-
Tai kept walking with Arcanine fir a while while whistling until he realized something.
"...Now that I think about it, I don't even know who HE is."
-
SUDDENLY-
Out of a warphole is shot out Flame, crashing into the ground beneath him.
Flame gets up, and tries to identify his surroundings.
"owowow... What happened there?"
He checks his atomic clock, and sees a discrepancy.
"Oh great. Am i just screwy, or was there yet ANOTHER Deus Ex Machina? I swear, one of these days... The space time fabric.. mutter mutter..."
after muttering to himself and readjusting his atomic clock, He once again takesa look around.
"where the HELL am I- Oh..."
Flame said, before being smashed into the ground by the Giant enemy crab.
((the one and only from the RPM map, FYI!))
-
[this isn't based on the map, Flame. It's an original creation... >_>]
After a few hours of walking, Mirby made it back to the desert, and found where she had seen Nova last. "This is the spot... the energies must've been pretty strong..." CRACK! "The heat from the energy made all this sand into glass... And... hmmm..." Using the Scann sigil, she idenified the energy trail. "To the west? But there's nothing but an ocean there! Unless... great, he's on the other side of the ocean. How the hell am I gonna get there?" She sighed, resigned and reluctant, and headed west.
-
(So it's pretty much like RPM 2 then?)
-
(Think alternate dimension)
Akamaru continues to shift his paw in the sand, letting the warm sun bathe in burning rays. After finding a good spot, he plops down and begins to play by himself. "Ahhh. It is so peaceful and calm. Just the ocean washing onto the shore and the warm sand is... sending me... to sleep". Akamaru then just falls to the side, asleep. After a few minutes, drool starts watering the sand.
-
[I suppose that's a... suitable explanation. Let's go with that. Flame was still smashed by the enemy crab and may or may not be dead though... depends on his future posting habits here... Ahem.]
Mirby finally made it to the coast; it was a lot closer than it seemed. She started walking in the sand when suddenly...
"HEY! WATCH WHERE YOU'RE STEPPING HERE!"
Mirby looked down and saw a dog. "Wait... did... did you just talk?"
-
Reluctant to keep wandering around aimlessly, he finds a man who appears to be on a jog and asks him if he knows where he is.
Apparently, not without a fight.
The man's skin starts to melt into the ground, only to form some kind of slime, leaving a skeleton man where the jogger was.
"Finally, someone who can be a good energy resource." The skeleton tuanted.
Nova responded to this with a high kick, though he wasn't the best hand to hand fighter, he could manage. He grabbed the skeleton head, placing energy around it, to throw it at the slime, who absorbed it without realization an explosion was imminent.
Nova once again kept going, not surprised by anything he might wander to, though luckily, the monster was carrying a map. Nova lifted it in his human fingers, studying it as to locate where he is.
"If I was in the desert there, then I ended up at the castle over on the coast.....It's going to be a long while till I find Mirby" Nova started to sprint to where he thought was east, judging by the desert and castle location.
-
After some time with no answer, Mirby realized she must have been hallucinating or hearing things or something. She kept walking towards the ocean... but slowly... "Everything's... getting darker... I think I'm gonna..." She collapsed on the shore, exhausted and tired.
-
Oh, it's that one. I thought I sensed them before but I wasn't sure... His thoughts trailed off as he looked over the horizon. Hm. His eyes narrowed. I'm still holding a grudge from before - naturally, of course. But, taking care of that matter will have to wait just a little bit longer. I sadly have, he smirked, more important matters to deal with.
"Well then." He walked forward. It's time to begin.
-
Everytime Nova felt tired, he ran faster, this "He" was a bigger problem than human exhaustion. The place where he landed was just a large expanse of land, monsters roaming to and fro and towns dotting the landscape. Fortunately the castle where he landed wasn't that far off from the coast, though Mirby might have been on the west side for all he knew, but it wouldn't hurt to try the desert.
Nova came to a complete stop, he noticed that energy was booming at his ears, lighting up his finger tips, he took turns pointing each one at a treee, sending a spark of lightning coarsing through thier bodies. As suspected, they toppled back, passing it on to another as Nova made his escape to what looked like the sea. He stood by a large cliff, seeing the sea below and a figure.
"Mirby!" Nova yelled as he jumped down, brushing off the impact of the fall like someone would brush off dirt on their person. He thought of what to do, then remembered how to check a human pulse, gently puting his ear on top of her chest, sensing her heart beat. "Thank god, she's alive, though I guess I'll need to carry her......later..." Nova fell onto the white sand, too tired from running and fighting. "Least my human form got some exercise..." He thought.
-
Spectro walked out of the repair shop, shinier than ever. He walked down the street, when he realized that he had nowhere to go.
"Humph. This is getting stupid..."
He sat down on the pavement and began to ponder how it was that he got here.
-
SUDDENLY-
Out of a warphole is shot out Flame, crashing into the ground beneath him.
Flame gets up, and tries to identify his surroundings.
"owowow... What happened there?"
He checks his atomic clock, and sees a discrepancy.
"Oh great. Am i just screwy, or was there yet ANOTHER Deus Ex Machina? I swear, one of these days... The space time fabric.. mutter mutter..."
after muttering to himself and readjusting his atomic clock, He once again takesa look around.
"where the HELL am I- Oh..."
Flame said, before being smashed into the ground by the Giant enemy crab.
((the one and only from the RPM map, FYI!))
Before the GEC could finish Flame off, a hail of cannon ball shots made the large beast to retreat. A huge pirate ship stopped near Flame. The ship looked like an old pirate ship, but it had mechanical parts, which seemed allowed the ship to be slightly floating above the ground. Two sniper joes dressed in pirate outfits jumped down to Flame and picked him up.
"CAPTAIN! THE MAN IS STILL ALIVE!"
Yelled one of the Pirate Joes towards the ship. A man was looking down from the ship, it seemed he was the captain.
"Good, bring him on board, we gotta bring him somewhere safe."
(Guess who lost his memories and became a pirate captain? 8D)
-
[this isn't based on the map, Flame. It's an original creation... >_>]
Says who? It's whatever you want it to be.
-
Akamaru wakes up and looks around. "Damn. Another wet dream. Who dreams of being stepped on- Huh?" Akamaru walks a little forward to find both Mirby and J Por Favor sleeping together. He suddenly comes up with a misunderstanding. "Since they are here together, alone... They must of..." Embarrassed and turning a red, that thankfully can't be seen due to his fur, he turns around and walks away towards the peer with his small boat. "Fishing seems so nice to keep my thoughts in order."
-
[disregard Lucky's message; we cleared it up in MSN.]
-
Nov awakes to find that he once again found Mirby.
"Morning, Mirby, time to get going..." Nova said, not in the least bit wanting to get up much less walking somewhere.
-
((I still couldnt come up with anything else, and giant enemy crab battles are always the way to go in that case!))
"Urrgh..."
Flame got up, sore from being pounded by a giant crab.
"ugh... my body hurts... Blackhook?"
-
Mirby was lost in her dreams. She was remembering the fateful battle seven years ago.
"YOU! You've destroyed enough lives! You've flattened enough cities! The end that you've brought to so much will now be brought upon you!" Mirby exclaimed. He said nothing, but instead covered himself in his cape and vanished. He laughed menacingly. "Nova, I need your help!"
"What do you need me to do?" asked Nova.
"We need to combine our powers. This is our only chance!"
"Okay!" Suddenly, both Nova and Mirby started glowing. A bright white aura started to surround the two, and millions of particles started to emanate from the aura.
"NEUTRON SEAL!" they exclaimed simulataneously. Suddenly, the memory ended, much like a roll of film. A voice echoed from all around the emptiness.
"I told you I'd be back. And now, you will pay for exiling me inside that star. I will see to it that all you know and all you care about comes to a violent and bloody end!" Laughter echoed and faded away. "When we meet next, prepare for your end!"
Mirby awoke suddenly. "What... where am I?" She looked around and found Nova. "Nova? When did you get here?"
-
"Since I found you here and tried to get you somewhere, though I was too tired, so I fainted right next to you, hope you don't mind." Nova said, looking away. "You were saying something about a Nuetron something or other, I just woke up" Nova said, still in the same position he fainted in. "Ummm, lets get going!" Nova got up, feeling sore all over from sleeping on sand with nothing but a Mirby pillow.
-
"Where shall we go?" Mirby asked.
"Definitely not where I just came from... I don't know... Can you sense him?" Nova inquired.
"Yeah, he's somewhere to the southeast. I think we should go northeast; that's where Lucky was. Maybe he can help..." Nova nodded in agreement and they set off towards the grasslands.
-
"Sorry if it offends you Mirby, but who exactly is "He". I have only been on this planet for some time, so I do not know most of the people here." Nova said, trying not to give her more shivers.
-
"Right... your memory of the battle was lost... To be honest, I barely remember it myself. All I remember is sealing him away. He was a great menace, a great evil. He leveled cities at will, killing millions of innocent people. I don't even remember his name; all I know is that he's bad news. And when he's around, I can't really use my powers as well as I normally can. He needs to be stopped, that's the one thing I know for sure. Now, let's go see if Lucky's still in the grasslands."
-
"Seems the alternate dimension time lapse has made me forget things. Though I didn't forget you, "He" Must have done something to me. On the other hand, I've learned how to become fully human, look, blood!" Nova said, amazed he could create a full body for himself as he cut a small gash on his wrist. "Though it has some human side effects." Nova kept walking where Mirby was directing him, using his nose to smell the aromas.
-
(Not one to let a good arc go to waste, I've decided to keep the A.RPM arc going but now modified and refitted for Busier world placement with a new plot! 8D)
Meanwhile in the Alternate RPM, a shadow eclipses on a rather nervous and sad A.DWII. "Doctor!" Said the shadow in a horrid and harsh voice not unlike the TMNT Shredder voice, "What news do you bring to me upon the development for my latest weapon to destroy that cursed annoyance that always interferes with my plans?" A.DWII slowly turned, "N-n-no master, but I did-AH!" he was cut short by a punch square to the face. "FOOL! I do not keep you around to waste my time! I need results not my precious time wasted!" *>8|* He was about to strike A.DWII again when the A.Doc blurted, "ButyourexcelenceIfoundsomethingthatmayprovetobeevenmorepotential!" *O^O* He flinched but then realised the figure stopped in thought. "Hm...you say this is more potent then my current plans?" He turned to the large window allowing him to view A. RPM, "Tell me of your...discovery." The doctor brought out his palm top and gulped as he uploaded the data onto the main screen, "Well it seems there have been some disturbances in the area, very powerful and almost...impossible at the same time." The figure looked at the results,"...investigate this more, and take your lab rat with you."
Else where in A.RPM both A.Afro and T.Afro sneezed.
(P.s. Might I infer who 'HE' is?)
-
[He is obviously Archer's new character; a name would be useful, but you'd have to ask him. Just know this: it's NOT Roa]
Mirby and Nova continued to walk and entered the grasslands. But Lucky was no where to be found...
"What now?" asked Nova.
"Let's go to that city. There's a great sandwich shop there!" Mirby replied.
"Food again? Meh, I could eat," Nova said. They headed east towards the city.
-
((I still couldnt come up with anything else, and giant enemy crab battles are always the way to go in that case!))
"Urrgh..."
Flame got up, sore from being pounded by a giant crab.
"ugh... my body hurts... Blackhook?"
The pirate captain looked confused at Flame.
"Huh? How do you know how they call me? Do I know you? I am not sure...
Captain Blackhook showed his left arm arm on which end there was no hand but a bick black shiny hook.
-
From somewhere a few miles east of the grasslands, an interdimensional rift opened up and spat out a young man that looked suspiciously like Lucky, albeit with darker - purple, to be precise - clothing, shades with tips that marginally curved upwards, sharper eyes and a tattered scarf around his neck.
"Damnit," he hissed, climbing back onto his feet and adjusting his eyewear, "That's the last time I go lookin' at transplanar portals without a damn good reason. Now where the hell am I?"
Looking around, he noticed a wooden sign in front of him.
WELCOME TO RPM
DON'T STEAL ANYTHING
NOOBS NOT WELCOME
"R...P...M? Well, while I'm here, I might as well have a bit of fun."
He noticed Mirby heading eastwards. With a sinister smirk, he ran after her.
"Hey! You! Yeah, you!"
-----
Elsewhere, Blackmore and Deathwatch were enjoying a pleasant morning stroll, with the sky turning dark, the air becoming choked with fog and the flowers wilting with their mere presence.
"I think now would be as good a time as any to enjoy a little spot of universal conquest, wouldn't you say, old boy?"
"Indeed, my lord. Shall I ready the Darkaiser Castle?"
"Oh, you know me all too well~!"
-
Mirby saw someone running towards her... "Lucky... no... wait..." She used the Scann sigil to investigate the area for any energy fluctuations. Sure enough, there was one coming from behind "Lucky."
"Hey! You! Yeah, you!" "Lucky" said.
"I know who you are. You're not of this dimension, are you?" Mirby asked.
"Umm... Mirby? A second please?" Nova asked.
"What is it?"
"I thought you couldn't use your powers because of 'him.'"
"The Scann sigil is about all I can do... Luckily, his presence doesn't interfere with that."
"Ah, right. Carry on."
-
A. Lucky grinned, revealing a mouth full of notably sharp teeth. "Not from this dimension? Aw, shucks, what are you talkin' about? It's me, Lucky!"
-----
The skies above darkened, becoming a sea of infernal crimson ether, the clouds fading away into whisps of thick black mist. An enormous hole in dimensional space was forcibly torn open, creating a circular portal in the sky. From this portal emerged a gigantic castle, darker than the darkest of black shades, floating of its own accord and surrounded by an ominous, spiralling curtain of indigo haze and fog. The castle slowly lowered itself to the ground level, scorching the grassy floor as it touched down.
"As requested, my lord," said Deathwatch with a respectful bow, "The Darkaiser Castle."
"Oh, it's been so long," cackled Blackmore with wicked glee. He and his ghastly companion made their way inside, and the castle once more took to the air. "Let's get going, Deathwatch; there's so much to conquer and ravage, I can hardly contain myself! Hyeeeeehahahahahahahahahahahaha!"
-
"Look, I know you're not from here. The Lucky I know doesn't have sharp teeth. The Lucky I know doesn't have sharp eyes like yours. And the Lucky I know... isn't you. So move along; I'm looking for the Lucky I know, not some evil doppelganger. Goodbye." Mirby continued on her way.
"Wasn't that a bit harsh?" Nova asked.
"Really? You saw how menacing he seemed. Something's not right. If some odd doppelgangers suddenly appear... then the space-time fabric isn't right. This... this might explain how he broke free, actually!" She broke into a run.
"Wait for me!" Nova exclaimed, chasing after her. "Where are you going?"
-
"Oh no ya don't," hissed A. Lucky, turning on his heel and chasing after Mirby and her companion, "I'm not lettin' someone as delicious as you get away!"
-
Oh, so someone else is going to make their move, huh. The man thought as he looked at the castle that was flying in the sky. Perhaps I could use this to my advantage. I suppose I should introduce myself.
-
"Umm... Mirby... he's chasing us," Nova said, oddly calm.
"There's only one thing to do. I'm gonna have to risk my powers."
"But what if something goes wrong?"
"So be it. I'll not be caught by that maniac!" She traced the Gaia sigil, causing a massive canyon to be created. Unfortunately, "Lucky" was still on solid ground and the canyon was directly beneath Mirby and Nova's feet.
"Well, now what?" Nova asked.
"This does prevent a slight problem." She traced the Stracumu sigil, causing a cloud to appear beneath them. Unfortunately, they fell right through the cloud.
"The ground's getting closer, and we show no signs of stopping..."
"I got it, I got it!"
"You know, you're oddly calm for a time like this, Mirby."
"Calm? I'm freaking out! One last thing to do!" She opened a CSR below them.
"Where will this take us?"
"I don't know, but anywhere's better than here!" The CSR engulfed them both and promptly popped out of existence.
Meanwhile, on the other side of the canyon, a man fell from a freak rift. He was similar in appearance to Mirby, similar demeanor, but male. He was also quite powerless.
"Aaaahh! Oof! What... what just happened? Last thing I remember was drinking some Mango Lemonade and then a hole appeared and sucked me in... Where am I?" He saw a sinister figure on the other side of the canyon. "Great... Lucky's here. Crap." He ran the other way as fast as he could.
-
A. Lucky snarled as Mirby and Nova escaped, but his rage quickly subsided once he saw A. Mirby appear before him. He grinned, licked his lips and leapt across the gorge to chase him. "MIRBY! GET BACK HERE! I'M STARVING!"
-----
"Now, then...what should be our first act as the future rulers of RPM?"
Deathwatch, as his master mused sinisterly, polished the blade of his scythe dutifully.
-
"Before you make such...bold statements, wouldn't it be best to first have some more allies on your side?" He asked as he casually walked into the throne room where Deathwatch was currently located.
-
A. Mirby looked back. "Crap! Why'd I look back?" He tripped and rolled down a hill. A freak tear in space opened up and swallowed him, the vanished out of existence.
When he reappeared, he was in a city. He rolled and stopped at the entrance to a repair shop next to a sandwich shop.
[Your timing here is great, Arch. Adds a bit of dramatic flair, if I do say so myself]
-
A. Lucky growled and stamped the floor vehemently. "Damnit! That was my lunch!"
-----
"Who are you?" demanded Deathwatch, instantly holding his scythe out, ready for battle.
"Oh, Deathwatch, you really must learn not to treat everyone as your enemy~" Blackmore approached the newcomer, still grinning eerily. "And who might you be, my boy?"
-
A sly smile spread across the man's face.
"I don't like giving out my true identity so freely. But, if you wish for name to put to my face then...you may call me Eden." He gave a slight bow. "And you would be?"
-
"A pleasure to make your acquaintance, Mister Eden. As for myself, I am Lord Blackmore, the lord of chaos and fear. Whatever brings you to my humble abode, hmm~?"
-
"I was merely curious of your, ah, operation. I've been bored, you see. This world is so dull, but for the time being I have no choice but to remain. So it I thought I might as well make the most of it...." He trailed off twirling a lock of hair from his fringe.
-
Meanwhile in A.RPM, We find A.DWII and A.Afro exploring several spots where this "Disturbance" had taken place. "Hm...interesting Doc. It seems that these spots have recently radiated some kind of energy. It's nothing like the kind we have here." The Doc nodded in agreement as he took note of this and other information. "Looks like you may be in luck Afro, a discovery this big might just let you help lighten your debt with the master." Afro stood in thought, "Yes....It would." They kept on traveling all over A.RPM studying the multidimensional rifts that allowed A.Miby and A.Lucky to enter RPM.
Elsewhere in A.RPM T,Afro continued to talk with A.Jasmine learning more of A.RPM.
-
Meanwhile in A.RPM, We find A.DWII and A.Afro exploring several spots where this "Disturbance" had taken place. "Hm...interesting Doc. It seems that these spots have recently radiated some kind of energy. It's nothing like the kind we have here." The Doc nodded in agreement as he took note of this and other information. "Looks like you may be in luck Afro, a discovery this big might just let you help lighten your debt with the master." Afro stood in thought, "Yes....It would." They kept on traveling all over A.RPM studying the multidimensional rifts that allowed A.Miby and A.Lucky to enter RPM.
A. Wily II and A. Afro were accompanied by A. Silan, who was quiet the whole time and just kept looking around and listening to the two.
(Note: A. Silan is working for A. Wily and she is personality wise wery different from Silan, she is very loyal and trustworthy, but she shares Silan´s trait of proving herself better than others, though not so much as the original. She also looks a bit different than the original. Her hair isnt spiky, but shoulder length and wavy, she wears a similiar outfit as the old one Silan wore but instead of a scarf a collar is hiding A.Silan´s mouth.)
"Dr. Wily? Please allow me to suggest something. Shouldn´t we send someone to investigate the other side?"
-
"You do have a point, but that would take some time as we don't know the exact location this energy source is coming from." A.DWII pointed out. "There maybe a bigger source around here though doc, and if we can find the biggest source, it may just let us explore this "Other side" to where some of the citizens have been disappearing to." A.Afro suggested. As they were discussing this the shadowy figure from before stood and watched over A.RPM. "Soon I will not only completely control this world but also destroy my nemesis as well!" He opened a draw and pulled out a new clipping of an Afroed vigilante super hero, "Soon...soon we will see who has the last laugh AfroMan." He crumbles the picture and laughs menacingly to himself.
Back with A.Afro, A.DWII and A.Silan, A.Afro got a small shiver up his spine. Hm...I need to find out what this energy and other side can really do before our master can. He thought to him self.
Meanwhile, with T.Afro and Jasmine. T.Afro saw various newspapers abut a vigilante super hero named 'AfroMan'. "...you can't be serious...this is what I am in this dimension?" T.Afro held the newspaper crumpling the edges as he read on about AfroMan. Jasmine came back from the cafe with two drinks. "Oh you're reading up on AfroMan again huh? I can tell if you two ever got together, you'd become friends real fast." She said with a blissful ignorant smile. "Um...yeah, we sure would." said T.Afro, remembering to not blow his cover and accomplish what he came here for.
-
Suddenly- Lucky's castle.
"Blackhook... Do you see that odd very evil looking castle there? Or am I going loopy?"
"Aah great. what is this Castlevania now? What, is Dracula back AGAIN?"
-
Suddenly- Lucky's castle.
"Blackhook... Do you see that odd very evil looking castle there? Or am I going loopy?"
"Aah great. what is this Castlevania now? What, is Dracula back AGAIN?"
(Actually is Blackmore´s castle...but whatever)
"Why are you talking so familiarly with the captain?"
Asked a reploid pirate.( Besides the pirate Joes there are also pirate mets, pirate reploids and some normal human pirates)
Blackhook looked at the reploid.
"Don´t worry, I am nobody special so there is no need to be formal with me.."
He then looked towards Blackmore´s castle
"That is surely wery strange...I can feel an ominious presence from that place"
The ship was sailing towards the location of the scary castle.
"We mustn´t get any closer to that place, I cannot risk the lifes of my crewmembers, anyways I didn´t quite catch your name stranger. May I know it?"
-
Flame looked over at Blackhook. there were a few possibilities. He was in some alternate universe, Something happened and gave Blackhook amnesia, or he went back in time. conferring with his atomic clock readngs, as well as the date- he went with the second.
"Flame..."
"Tell me Captain, what can you tell me about yourself?"
-
(Wait so this RP is taking place in RPM, but is it still the same time? Or was Flame just making an educated guess. o3o)
-
Flame looked over at Blackhook. there were a few possibilities. He was in some alternate universe, Something happened and gave Blackhook amnesia, or he went back in time. conferring with his atomic clock readngs, as well as the date- he went with the second.
"Flame..."
"Tell me Captain, what can you tell me about yourself?"
Blackhook was suprised by that question
"Why that is a very interesting question Mr. Flame, the answer though won´t be long, truth is I don´t really know who I am. One day I found myself stranded in this desert without any memories of my previous life, without the knowledge of why I have this hook instead of a hand...So I just started aimlessly wandering. Then I pet this people, who were attacked by monster scorpions or something like that,I was able to safe this people and from then on I became their leader.They started callin me Blackhook, because of this hook...but it seems that that is my real name? Who would have thought.
They told me that they were once living in a city that got one day suddenly attacked by a robot army, which completely destroyed their homes, the next that happened was that all of them somehow got here. None of them has place to return to. The life was pretty tough, but we found this miraclous ship and we were able to travel wherever we wanted to, but we decided to sail around this area in search for other people who might have stranded here..."
Suddenly BH started laughing
"Oh my, it seems my short answer got pretty long, but I hope you are satisfied with that, Mr. Flame"
-
Blackmore stared at Eden for a moment, as though to assess him, then held a metallic finger up to the newcomer's face.
"You wish to join me in my little crusade, do you? Well, now, isn't that interesting. I could let you tag along with me, but unfortunately for you, I'm not one to take chances on people I don't - even - know~"
-
Meanwhile, in a place separate from RPM, or maybe it's the same but elsewhere... Regardless, somewhere...
"Umm... where are we?" Nova asked.
"I... I don't know..." Mirby replied. Suddenly, words started to appear out of the abysmal darkness.
YOU ARE IN A SAFE PLACE, they said.
"What... the..." Mirby started to say.
YOU MAY ASK ONE THING, the words said.
"One thing, eh?" Nova said.
"There's one thing I need to know... and that is... what is his name?" Mirby asked.
YOU KNOW THIS ALREADY. LOOK DEEP INTO YOUR HEART, AND YOU WILL FIND THE ANSWER YOU SEEK.
"Deep into... my heart? But... I... hmmm...." Mirby thought for what seemed like a long while, even though time meant nothing in the place her and Nova found themselves. Suddenly, a spark of memory... "Eee.... Eeedddeeemm... no... Eden... EDEN! I think... I think he went by Eden!" Mirby exclaimed.
CORRECT.
"Wait... why does his mere presence affect my powers so much?" Mirby asked.
THAT YOU WILL HAVE TO FIND OUT ON YOUR OWN. AND WHAT BETTER WAY TO DO THAT THAN TO ASK HIM YOURSELF?
"Wait, what?" Suddenly, a hole opened up and deposited both Mirby and Nova right into Blackmore's throne room.
"Crap," commented Mirby.
-
Blackhook was suprised by that question
"Why that is a very interesting question Mr. Flame, the answer though won´t be long, truth is I don´t really know who I am. One day I found myself stranded in this desert without any memories of my previous life, without the knowledge of why I have this hook instead of a hand...So I just started aimlessly wandering. Then I pet this people, who were attacked by monster scorpions or something like that,I was able to safe this people and from then on I became their leader.They started callin me Blackhook, because of this hook...but it seems that that is my real name? Who would have thought.
They told me that they were once living in a city that got one day suddenly attacked by a robot army, which completely destroyed their homes, the next that happened was that all of them somehow got here. None of them has place to return to. The life was pretty tough, but we found this miraclous ship and we were able to travel wherever we wanted to, but we decided to sail around this area in search for other people who might have stranded here..."
Suddenly BH started laughing
"Oh my, it seems my short answer got pretty long, but I hope you are satisfied with that, Mr. Flame"
Flame scratched his head. Option two it most certainly was.
"well- you are- or were- Anyway... I seem to be quite lost myself- a citizen of a city named 'RPM'. Biiiiig place. And sure enough, your name is Blackhook. I wouldnt know of your origins BEFORE arriving at the city, but I DO know you were a person from there. Hm. You were a big help when this one near immortal vampire rewrote history to make himself ruler. We of course lost in the end, the surface was obliterated, he became completely immortal, bonded with the planet and we needed to summon a Dragon God to turn back the clock to the way things were... Buuuut thats a long time ago. Man it sucks you cant remember anything. Or maybe its for the best, I dunno. "
Flame looked around, seeing nothing but desert and a few crabs. He tried to communicate with FAUST, but the communications seemed to be disrupted, most likely by the castle that appeared.
"Eeehhh... My communications with my own crew seems to be being messed up by that floating castle up there. Do you mind having me along till we reach land that ISNT sand?"
-
Blackmore snapped his fingers, putting up a powerful jamming aura that would ensure nobody could teleport in and out of Darkaiser without his permission. No sooner did Mirby appear than he was standing over her, glaring down at her and grinning wickedly.
"Well, well, what do we have here? A little girl?"
-
"You... you don't scare me! I don't even know why those weird words sent me here! MIRBY AWAY!" She tried to use a CSR to escape, but when she tried opening it, pain shot throughout her entire being. She lay there, helpless and paralyzed. Meanwhile, Nova managed to escape.
-
Deathwatch took it upon himself to remove Mirby's paralysed body and eject it from the castle walls. It just so happened that A. Lucky was walking by, grumbling about food, when he saw her unconscious form.
"LUNCH!" he cried gleefully, grabbing Mirby and dragging her off to parts elsewhere.
"And now that that's taken care of...where were we?"
-
Mirby was tied to a rotisserie, unconscious and ready to be cooked. The fire was lit. Suddenly, the Volcan sigil started glowing and a fireproof shield engulfed Mirby.
Meanwhile, A. Mirby was walking along and suddenly saw a massive castle-shaped shadow and a girl tied to a stick above a fire, with a reddish aura around her. No one else was in sight. He ran up to her and untied her. She was unconscious, but she looked oddly familiar. He couldn't place her. He decided to pick her up and carry her away from the fire; being cooked alive was no way to go.
[Nova, don't RP Lucky's chars; that's a pet peeve of his]
-
[Seems I missed something then, you guys went too fast for me]
-
As A. Lucky was rubbing his hands together with savage delight, licking his lips and getting out the jars of seasoning, A. Mirby had taken Mirby away. He turned around, ready to season her nice and good, only to find - to his horror - that she had gone.
"NOOOOOOOOO! THAT WAS MY LUNCH!"
-
As A. Mirby carried Mirby far away from that freak, he suddenly had a thought. The thought was this. "I'm hungry. Maybe I should go back to that sandwich shop." He dropped Mirby and walked back to the city, being sure to avoid the campsite.
As Nova was running, he tripped over something and rolled headfirst into a tree. He got up, looked around, and saw what he tripped over. "Mirby!" He picked up a rock, and threw it at her.
"Ow! What was that for!" Mirby said suddenly, reviving instantly.
"I wanted to wake you up quickly. That cannibalistic freak is nearby!"
"Oh, then let's get out of here!" They took two steps and fell into a freak rift.
When they reappeared, they were on a small island. "Great... now what?" Nova asked...
-
Spectro picked up extremely errant and strange energy readings from high above; he looked up and saw a menacing, flying castle, shrouded in an aura of menacing-ness.
"Now that's quite a rare occurrence," said Spectro as he tried to obtain any sensory input he could from the structure. However, upon doing so, his entire body began moving of its own accord, walking to some unknown destination.
"Hey. What gives?"
-
"Damn, seems like the one disrupting your transportation is getting stronger." Nova said, trying to clear away water with blasts of wind attacks.
"First of all, We need to get off, or get food, whichever comes first."
-
(So, what can I do if I want to be anything resembling relevant?)
-
(So, what can I do if I want to be anything resembling relevant?)
Anything you want. There's not much a plot here at the moment, and Lucky is still all by his lonesome.
-
[whatever you want, I suppose. Don't RP with Lucky's characters though. The best bit of advice is have fun.]
-
"Is that...so." Eden raised and played with his hair. "That's fine, I shall take my leave then." And left before Blackmore could do anything about it.
-
Akamaru has been floating on the ocean for some time. By some time, I meant all thee time that it would have taken for the prior post's events unfolded, which would be a long while. All the while, Akamaru near falls asleep when his Good Rod finally catches something. Quick to his feet, he fights the line and reels in his catch. "HIYAAAA!" With a quick twist of his paw, he pulls in the "fish" onto the boat. There, he sees himself flopping.
Akamaru: "Huh...?"
????: "I was fished by my self...?"
Akamaru: "Yep. Your name?"
????: "Maru. Can you untie me?"
Akamaru: "Yep. There is a Old Rod over there and I am starving. Help me grab at least some dinner."
Maru: "Alright."
And the two continue fishing as if nothing happened. Why was a dog fishing and caught another dog, is beyond me, but that is what their story is like.
-
[whatever you want, I suppose.]
( Well, yeah I know that, but can't say I've really been following what's happened since last time posted which is why I asked)
-
Flame scratched his head. Option two it most certainly was.
"well- you are- or were- Anyway... I seem to be quite lost myself- a citizen of a city named 'RPM'. Biiiiig place. And sure enough, your name is Blackhook. I wouldnt know of your origins BEFORE arriving at the city, but I DO know you were a person from there. Hm. You were a big help when this one near immortal vampire rewrote history to make himself ruler. We of course lost in the end, the surface was obliterated, he became completely immortal, bonded with the planet and we needed to summon a Dragon God to turn back the clock to the way things were... Buuuut thats a long time ago. Man it sucks you cant remember anything. Or maybe its for the best, I dunno. "
Flame looked around, seeing nothing but desert and a few crabs. He tried to communicate with FAUST, but the communications seemed to be disrupted, most likely by the castle that appeared.
"Eeehhh... My communications with my own crew seems to be being messed up by that floating castle up there. Do you mind having me along till we reach land that ISNT sand?"
One of the pirate joes quietly told Blackhook:
"I think the crab and the heat kinda messed up with that guy..."
Blackhook then replied to Flame´s question
"Well mr. Flame, the is a city nearby, we might bring you there."
"What! You believe what he just said?!"
"Well what he said is just as believale as all the things we went trough, Mr. Flame, this place here is also called RPM. But it does seem to be a different RPM than we came from. I don´t know what happened. I think we should find out"
-
"Different? In what way? And please, cut the 'Mr.' You dont need the formalities with me."
-
With a flash of lightning and the roar of thunder, a giant building in the shape of a blue knight's helmet seemed to appear out of nowhere and affix itself to an area where no people would be crushed by it's arrival. After it had finished moving, a tall man wearing a similar helmet, blue armor, and a long, brilliant red scarf, walked out of the only entrance to the building.
"AAaaahh... I finally make my debut." He said, taking several steps away from the building, turning, and looking up at it. "Hmm... Something's missing... Can't quite put my finger on it though..." He muttered, pantomiming the act of scratching his chin. "Ah well, probably not very important anyway. Ladies and Gentlemen, Sapph's is open for business!"
-
Blackmore chuckled a little to himself. "Poor boy. Oh well, I'm sure he'll be alright." He turned around to Deathwatch. "How are preparations going?"
"We are almost ready to commence the operation, my lord," he said, "The Eye of Dante is at 75% power. It will take just another ten minutes to achieve full power."
"Hyahahahahahahah~" Blackmore cackled to himself, practically dancing around the room with giddy delight, "Wonderful, wonderful! Prepare yourselves, RPM - for the skies are darkening, dark forces are gathering, and all hope is being abandoned...the end is nigh! Hyahahahahahahahahahah!"
-
"Different? In what way? And please, cut the 'Mr.' You dont need the formalities with me."
"I don´t know, that is how my crew feels about this RPM. They say that it seems like it´s the same but it feels different"
-
"Mmm. Very well could be..."
-
"Mmm. Very well could be..."
"CAPTAIN! In front of us is a town!"
Yelled one of the pirates
"Huh? Well Flame we´re almost there, what are you going to do?"
-
"85%, my lord. Five minutes remain until full power is achieved."
The ground beneath Darkaiser Castle began to shake slightly.
-
The man in blue, presumably Sapph, had moved to sit on top of the helmet-shaped building. "Now, all I can do is wait...." He sighed, looking around at the surrounding area. "Maybe I should've actually explored the area a bit before pulling my place in..."
-
Meanwhile, in a forest, three strange looking figures (who go by the name StrangeMan, Nekolian and Brocky Bulldawg, respectively) fell from the sky.
"GAAAAAAAAAAAAAHHH"
"NYYYYAAAAAAAAAAAAHHHH"
"...Meh, I'm a bit hungry..."
A loud thud could be heard from miles when this three landed. Slowly raising themselves up and dusting themselves afterwards. The being with three seperate capes exclaimed: "That was a crazy trip! Who'd knew we get sucked into some wierd dimension right in the middle of that cooking contest."
"Ugh, I'm actually glad we got sent into that place, that contest was stressing me out" proclaimed the robotic feline-esque cyborg.
"...I'm getting hungrier..." The broccoli shaped creature muttered.
"It was kinda cool though. We fought cowboy ninjas riding mutant android unicorns, equipped with tornado creating missles! And we saved a kingdom, but that's not important." Said the caped man.
"And I got a kiss from a princess...nyar~ <3" The cyborg's face started to redden, his tail swayed from left to right as he remembed that moment in his life.
"...Er, that was a prince..." The dog faced broccoli told the feline.
"NYAR! She's a woman and you know it!" The cyborg shouted.
The caped man then replied: "Nno, I'm pretty sure SHE was a HE."
The cyborg began to shout "She's a she, a SHE!". He clawed the ground, ready to slash away at the two.
"Anyhoo, one good thing came out of it...we got some nice, new outfits"
The caped man had stitches on the side of his clownlike pants, which had the color red on the right and blue on the left leg. his capes had cybernetic markings like those commmonly found on chips, on the tips of said capes we're faces: One was an angry face, the other a sad expresion, and the last one that resided in the middle cape had a face with a curvy, yet polygonal moustache, wearing a monocle. His hood had a long tail, also stiched on the sides. The man wore boots, just regular adventure boots. And on his gloves were small bumps over his knuckles, and a large bump on the back of his hand. The man also seemed to wear a mask which glows in the dark, showing diamond shaped violet eyes, and a large grin.
The cyborg, as mentioned before, had a feline like body. His noise amplifiers were' large, a long segmented tail, with a orbpositor on it's tip. His shoulders we're like two spheres, both his forearm and leg had vector markings on them. A noticeable feature of this cyborh was it's dreadlock like wires hangin from under his helmet.
As the the creature...well he prettty much is a large broccoli with cartoonish legs, long large robotic arms and the face of a bloodhound with a large band-aid over his snout.
"So then...where are we, exactly?" Asked StrangeMan
"We're lost, that's what." Proclaimed the Nekolian
---------------------------
Elsewhere, a young girl named Caramel fell unto a seemingly barren wasteland.
"WHEEEEEEEEEEEEEE~!!"
She fell from a height which would kill most people, if not, it would break all their bones. She landed with a loud thud, leaving samll crater on the ground. She layed motionless on the ground.
After a few minutes she quickly sat up on her knees and shouted: "That was fun! Let's fall
again Mr.Bloody!"
"Silly child, I did
not make that dimentional rift...though if I did, I would most certainly ride it again." And eerie and distorted voice whispered from within her veins.
"Awwww...by the way, Mr.Bloody... *The child began to look around land* Where are we? Last thing I remember was that we were fighting some big bug."
"Appearantly child, we are in wasteland...how dull and boring! You'd expect a dimentional rift to send you someplace a bit more...fun." Answered Mr.Bloody.
"Well I'm bored." Caramel said as she let herself fall on her back.
She stared at the purple sky, watching omnimoud clouds pass by. She stood silent, just staring up at the sky, until...
"...Mr.Bloody, I got a question"
"What is it child?" The voice asked
"...Did I get bigger?"
The girl looked at her body, her once small 8 year old body, was now streched a bit. Her body was now of a 12 year old.
"Ah, yes, it should be. I thought your body was getting a bit cramped for me, so I decided to tinker a bit with your genes. Now you got the body of big girl!" The voice shouted.
The Caramel sighed.
"...I don't know *She then firmly placed her sleeved hands on her chest* Aren't big girls supposed to have those round things on them. What're they called again? Bubs?"
"Let's just say your a special case and I'm not a miracle worker..."
Suddenly, I large glob of blood came out from the child's nose. Chapping itself into a strange being.
It wore a white baron hat and bowtie. It had a sinister, curved smile adorning it's face. It had crazed eyes that stared into a person's very soul. It also had a long, curved and pointed nose and chin, much like a comical represantation of a devil.
The being looked at the child as it said to her: "besides, I needed those genes to make my new face." The creature teased.
The girl pouted "That's not fair! I wanted some bubs! Now I'm bored and bubless..."
Caramel continued to stare at the sky.
"Feh, I'm a bit tired after that training, I'll just take a nap whilst you stare at your sky.
And with that, Mr.Bloody returned to the veins of Caramel to slumber, for the time being.
----------------------
Elsewhere, Near Blackmore's Castle.
A tall and thin figure holding a sketch book slowly strolled the land.
"...Yosh...I'm getting bored of strolling. I really need to find myself a job...I wonder if that mall over there is hiring." He thought to himself, pointing towards the floating castle.
"Hmmm, must be one of those new portable malls I never heard about. I wonder if they make a good salary floating around from place to place?" The figure then ran towards the castle as fast as he could.
-
"95%, sir. One minute remaining."
The ground began to shake and rumble even more violently, and a large cannon in the shape of a monstrous eye appeared from below the castle.
-
"Hmph, something feels odd...I just don't know what.." Nova said, pretending not to noticethe sky seeming to warn Nova of something, too bad he couldn't understand what exactly it was. But he didn't care, if something was going to happen, at least it could help make something more understandable.
-
"This... this is an omen of ill fortune," Mirby said upon sensing a change in the air. Suddenly. unexpected, the ocean around the island started to bubble and froth... "Yeah, this is bad." The air she was breathing started to stagnate, the trees on the island took a sickly pallor, and the very warmth of life seemed to vanish. "Really, really, REALLY bad... The only way this could work is if the very energy of this world was being used for... for something it shouldn't... What could be happening?" The sky turned a deadly shade of red...
-
"Well, we can't do much if we're stranded on an island." Nova said, building up coruage, then looking at Mirby, not a least bit flustered at all. For once.
He stomped the ground, starting to shift the trees to create a makeshift boat. He presumed to jump onto it, extending his hand "Can you paddle fast, Mirby?"
-
"No, but the water can destroy that fast," Mirby said as the boiling ocean incinerated the boat.
"What? Aw man!" Nova said. "What will we do now?"
"I think... I think this is the safest place..." Mirby used the Scann sigil and pinpointed the source of the energy disruption.
"Where is it coming from?"
"That castle... the one we were warped to... And it's about to fire..." Suddenly, the Scann sigil broke, and the mortal forms of both Mirby and Nova came undone...
-
"100% power achieved, sir," declared Deathwatch, "Now preparing launch of the Eye of Dante."
"Marvellous! Ohhhhh, I don't know why I didn't think of this sooner, hyeheheheheheheheheheh~"
Slowly, the eye below the castle opened up and glared down at the rumbling ground below. It began to glow a sinister crimson hue. Deathwatch began the countdown.
"Five."
Energy gathered in the centre of the eye.
"Four."
The ground began to shake even more agitatedly.
"Three."
A. Lucky looked at the flying castle in the distance. "The hell?"
"Two."
Lucky, from the front of his ship, was also staring at the castle in the sky. "That can't be good..."
"One."
The energy stopped flowing into the eye. It was now pulsing madly, with thick veins of red energy glowing around the centre. There was a cold, ominous silence. Even the air seemed to stop moving.
"Fire the Eye of Dante!"
It did just that. In one mighty blast, a gigantic laser beam of blood-red energy crashed straight into the earth below, shattering through the ground and releasing a powerful shockwave across the burning floor. In that moment, a series of huge cracks appeared along the ground and spread out like a mostrous spider's legs. The ground rumbled and shook like the very planet was being thrown across the sky. Flames quickly began to issue forth from the fissures and cracks spread madly across the ground. Blackmore watched with grim delight as his plan unfolded before him.
Soon afterwards, the laser slowed down and eventually dissipated, leaving a gigantic flaming crater where it burned its way through the ground. Everything seemed quiet once again.
And then, from seemingly nowhere, came a mighty roar that seemed to shake the planet to its very core.
"Behold, RPM!" declared Blackmore, who had scaled the castle and was now standing at the very topmost tower, his cape billowing in the dark sky theatrically and terribly, "Your worst nightmare! Hell on earth is here at last! HYAAAAHAHAHAHAHAHAHAHAHAHAHAHAHAHAH~!"
-
Nova, realizing that his human form practically dissolved into thin air, escaped from its shell, knocked back on his heels, trying to understand what happened. Indeed this was not his day. As he tumbled onto the sandy shore, no control of his body, but still in control from his core. He released the flames. sending them to understand exactly where he was. Fortunatly, he ragained control of himself, seeing what happened to Mirby, just a soul.
"It appears that we finally get to battle" The water flowed into the cracks of the earth, Nova sprinting through them, jumping and dodging as the earth tried to devour his delicous soul.
With his very might, he ran towards where the laser erupted, obviously pissed off that someone believed they could do whatever they pleased to RPM
"You fool, making such a mark on this place." Nova said calmly.
-
[stuff]
[[Does this mean everyone's dead?]]
-
Now in their ethereal forms, Nova and Mirby watched in sheer horror and utter sadness as a massive rift appeared.
"This... this is bad. Very very bad... Let me try something..." Mirby opened a CSR and, much to her surprise, it worked perfectly! "Let's go... we need to seal this rift! Ready?"
"Yeah! Let's go!" They entered the rift and vanished from the now-devastated island.
[no, it's just a massive rift, not the end of the world. Confusing, I know, but that's what happened]
-
Blackmore laughed heartily at Nova's bold bravado below him.
"Oh, you simplistic little boy! How magnificent you are! You see that hole there? The big flaming crater you're standing beside? That, my dear boy, is The Abyss. You may know it as Hell, Gehenna, Shaitan, Abaddon, Tartarus...an evil rose by any other name would be just as deliciously hideous, as the saying goes. At any rate, I do reccomend you move. I somehow doubt the pleasant little creatures that live down there will be too pleased about my impetuous interruption~!"
A soul-chilling noise, the combined cacophony of thousands of eldritch beings moaning, gnashing, hissing, roaring, growling and shrieking all at once, emerged from the flaming pit. With it came things; things so undeniably monstrous and fiendish that they could only be described as things, or demons, or monsters. These things were of the foulest nightmares, things that could only be conjured forth by a horrendously gruesome mind, baroque beings that defied all senses of logic, taste and sanity. These nightmarish things crawled, leapt, flew and emerged from the burning inferno of The Abyss in their hundreds.
"I'm. Just. Getting. Started."
[[Does this mean everyone's dead?]]
No. Nothing has been destroyed. There is, however, a gigantic crater where eldritch abominations are coming to desecrate the land.
-
Meanwhile, in the heart of RPM City, three Afroed figures fell from the sky. One with a stern and serious face landed on his feet as if the fall was nothing, the other with a more sadistic and evil smirk landed kneeling, and punched the floor shattering it on impact and the third...well he just fell and landed face first in a water fountain.
"..." the two other figures just watched as the third got back up. "What the hell was that!?" shouted the soaked figure. "Hm...It seems we're back in RPM but it seems....newer." Said the stern one. "Bah, I don't give a crap any more Cap'n! All this madness is just my kind of town you know." said the sadistic one. "Yes...it does seem fitting for some one like you Mania, but we need to find DWII and our brother Afro." said Cap'n as he began to walk. "Uhg, fine. Come on 'Fro we're leaving." Said Mania to the soaked afro figure. "Hey I told you it's AGRO now. I just need to figure out how in the world my hair grew back so quickly...it's alsmot as if it was never cut in the first place." Said Agro as he followed Cap'n and Mania.
Else where, Waddle Dee fell right into his class room. "So...you think just cause your the new student you can come here and crash my desk?" said a rather feirce looking student. the waddle dee looked and saw he cras landed on top of the fore mentioned desk. "Looks like we need to teach him a lesson boys!" said the student as he cracked his knuckles and several rather muscular students came from behind. The waddle dee facepalmed before he got tackled.
-
The blast from the Eye of Dante caused the area around Sapph's to shake, and crumble, causing the building, with Sapph on it, to collapse. "AUGH! SON OF A--" Before he could finish, a large piece of rubble struck his head and knocked him out cold, burying him in the arena that made up most of the inside of Sapph's, covered in rubble. Sapph wasn't dead, but he'd be severely sore, and pissed off, when he'll wake up.
-
"Once again you save me from utter defeat, I should keep a tally." Nova said, his mind trying to process what happened.
"So a army of demons, how fantastically cliche, an army from the depths of hades, the souls of the damned. Come to reck havoc among the living and make them live in the coffins the demons oh so despised. Make them bow down in fear, or maybe enslave them all? Indeed closing the rift would end it all quickly. Or it could only be hopeless like the Titanic, where only very few shall survive and the brave workmen sink." Nova pondered.
-
Spectro finally got his body under control again, wondering what the hell was with the flying castle.
Then, as if in response to his questions, the flying castle fired a beam straight into the ground, creating a massive quake as it fissured the landscape, causing Spectro to fall.
After that was over, Spectro got up and tried to get a clear view of what happened. He wouldn't be able to see much from inside the city, but running over to the site of the blast would be suicidal. Still, there wasn't much to lose if he went to investigate, so over he went to the giant fissure.
-
Above the crater, the thin figure was flying above, gazing at the beasts and rift he oh so barely manage to evade.
"Eeeerrggh, that was too close. I amost fell down that pit of horrible, ravenous customers. Must be a sale going on" The man muttered to himself as his sketchy and cartoonish wings flapped merrily.
He chuckled "At least I know this place has good buisness. I just hope they still a spot open for me" He then flew over to the castle, in search for a job.
-----------------------------------------
A few minutes ago...
Caramel was still watching the sky, she was looking for clouds that resembled animals, objects or other people.
"That one looks like a' octopuss! That one looks like a' eagle! Ooh, that one looks like a space man!...this is borring." She pouted, as she usualy does when she's upset.
"It's no fun playing with myself. I need somebody else to play with me!" She shoutted angrily.
After her tamtrum, Caramel looked up at the sky, and to her suprise, she found a shooting star.
Seeing said star gave her a big smile on her face, Mr.Bloody told her that if one sees such a star, if they wish upon it, they deepest desire will come true...sadly.
She didn't undestand what he meant by that, but she knew that this way, she'll find someone to play wit.
So she closed her eyes and said: "Mr.Star, can I have a friend to play with...no wait ,make it lotsa friends! So many friends that won't get bored so quickly. Please Mr.Star, can you make that wish happen?"
And as she oponned her eyes, the ground began to shake. By the second, it shook stronger and more violent.
The land cracked and fell into the fiery abyss that laid before the eyes of the child. Soon after, the child too fell into the abyss.
As she fell down, she saw dozens upon hundreds upon thousands of beings. Big and small, short and long, with multiple limbs, eyes, mouths, tentacles, claws, teeth etc. She continued to fall, the spikes, claws , horns and teeth of the creatures scratched an tore parts of her skin off as she descended deeper and deeper into the flaming pit.
As she continued to fall, she saw the most unimaginable, most groutesque, mind ripping abominations not even concieved by the human imagination. Beings that would drive anyone who merely glances at them mad.
But what did Caramel do? She smiled. Because her wish was indeed granted, now she had an endless amount...of friends.
She closed her eyes and sighed happily. Then from within the flames of the abyss, one of the beings, which could only be described as a giant worm like monstsity made of melting corpses and large human teeth that formed various rings around it' entire body, swallowed the girl whole as it made it's way toward the surface. [ 8D]
-
Nova landed near the hole in the earth, he closed his eyes as he mended the earth, though the demons kept coming at him, so he decided to fight back. He slashed them away with his sword arm. Stabbing them and extending his reach as they attacked in rows. sending homing beams to grab them into a cluster as he took them out using his remarkable strategy. Although he was successful in taking down demons, they came in many different forms, with wings and large claws. Ones that rolled around, trying to pounce on him and rip his very core away from him. All their weaknesses where the lack of range, though some did.
"If only I could fight them all back, I am only one Starlight." Nova unleashed White-Nova from his body, doubling his abilities, only for the time that he could control the copies mind. He fought back with more ferocity, trying to hold back his copies mind from controlling him.
-
Akamaru and Maru continue to fish among all the destruction. The evidently massive laser that tore a massive crater on the planet went mostly unnoticed since they are floating on the water. Sure there where a few large waves, but that just increased their determination to capture dinner.
Akamaru: "You know... Why was my clone in the water acting like a fish?
Maru: "I don't know. I was just there for some reason."
Akamaru: "I see. I won't be fishing others in the water, right?"
Maru: "Nah. I don't think so."
And so, they continue to fish for some fish, while the fighting and destruction continues.
-
The thin figure managed to make his way through the ever growing number of eldritch beings. He rested on a nearby ledge.
"Flying is tiring...luckilly I got here withouth having to fight tos grizly beings...makes me wonder just what this guy's are selling." He thought to himself.
He opened up his sketch book ad ripped out a piece a paper. The paper has a sketch of a man with the same shape as the one holding the very same drawing, it also bore the same wings the thin man had mysteriously sprouted.
From his belt, he took out a small capsule. The man pressed the button on the capsule and it instantly transformed into a lighter. He used said lighter to burn away the sketch.
As the paper burned, so too did the man's wings.
"I have such a useful ability" He told himself. "Now then, let's see if I can get a job"
The man then began to climb up towards the nearest window, rather slugishly.
Suddenly a demon clawed the man from behind.
"AAAAAIIIIGH!! The hurt you dick...I'm trying to...climb...here..." The man starred down, he was quite high up from what used to be the ground.
"...I shouldn't have erased those wings" The man began to sweat. He held tight to the bricks of this great structure of evil. The demon swooped towards him for a second attack.
Things looked grim for the man. Since he had no other choice, the man had to defend himself the only way he could.
He oponed up his sketch book to begin to draw, however, since he had to hold himself up with his drawing hand, the man could not properly draw.
The demon drew closer, th an had to think fast, lest he plummet to his death or be maulled by a hellish being.
Suddenly, a pencil with a perculiar design appeared in his mouth. He hasty drew on his sketch pad, the demon was drew closer, its claws ready to tear at the man.Its maw drooled with anticpation over the thougt of feasting on the man's entrails.
Out of nowhere, a strange swarm of scribbles appeared and pounced the demon. It seemed to mimic a mouth and bit the abomination, it's many scribbles skewering the whole body of the being.
The demon fell, asthe scribbles continued to bite it, all the way to the bottom of the abyss.
"Erg, those customers are fierce. I really hope I don't get fired on the first day for this."
The man quickly went up the window and entered the castle.
"Phew....gonna take a break before applying for a job here." muttered the man, finding a corner to sit down and rest his tired body.
-
Lucky watched the carnage from afar, wondering whether or not to get involved. He knew well enough that Blackmore never had any motivation behind what he did, other than a twisted desire to wreak havoc and cause devestation. He was chaos incarnate, it seemed.
Lucky sighed and walked back to the main cockpit of his ship. He couldn't just sit here while Hell was, quite literally, being raised.
-----
The pit seemed to go on forever and ever. No matter how many things were slain, more and more rose out of the pit to tarnish the world of the living. Blackmore was, of course, taking great pleasure in watching the world descend into insantiy beneath him. As though to accentuate his blasphemy, he reached into his cap and produced a large book, leather-bound, with a crimson cover and a large pentacle on the front. He opened it towards the end and flipped through a few pages until he found what he was looking for. In a loud, booming, dramatic voice, he read it aloud.
"And yea the pit did open, and the ground was torn, and the sky was coloured dark with blood and shadows; and from the pit did emerge foul daemons, the legions of Hell, to bring despair to saint and sinner alike."
The ground rumbled again, and the cracks spread even further across the ground. More and more flames blasted out of the fissures on the earth, hissing and seething and spitting out like fiery tongues.
"And as the men and women of mortals screamed and howled lamentations and prayed, a great Beast emerged from the fiery pit. They beheld the Beast, having a body like blazing hellfire, and six arms, and four horns, and many eyes, and a maw like the pit itself. They beheld in awe and fear as the Beast emerged, climbed from the inferno of the pit, and with flames issuing from its many eyes and mouth, gave a roar that shook the world."
Indeed, as Blackmore read out the verse, the Beast he described slowly emerged, clambering its way out of The Abyss and and bellowing fire from all over its gigantic body.
"RAAAAAAAAAAAAAAAAAAWWWWWWWWR!"
"And yea, though the world of mortals feared the Beast, they stood in awe of its great power. And in their fear and awe, they abandoned their god and fell to their knees and gave worship to the Beast."
Blackmore, grinning like a madman - which he was, of course - leapt from the high tower and landed on top of the Beast's head.
"And the people offered worship upon the Beast, and they declared thus: "Who is like unto the Beast? WHO IS ABLE TO MAKE WAR WITH HIM?""
Little did anyone notice the Darkaiser Castle, moving ever so slowly.
-
4 figures were standing and watching the beast emerging from the pit.Wearring white armors and carrying weapons in their hands they were discussing with eachother
"Hwa-ha-ha-ha-ha, now this is one hell of a party, what about it guys, shall we play the 4 horsemen?"
Said Ritter Sonne, the knight who´s wearring a mask shaped like an evil looking sun. Stolz, the young woman replied to him:
"We are looking for the misstres, we have no time for pitty games"
The smallest of the four - Schimmer then suggested
"We landed in this world and the first thing we meet is hell...don´t you think this is the chance to proove that the armor created by the misstres can wistand the forces of hell, what do you thing, Sieg?"
The leader of the 4 and the oldest one Sieg didn´t answer, he looked around and saw the spot where Carammel was just standing.
"Those monster make hold from nobody, they are a threat for this whole world, we should stop those beasts"
"Stop them?" asked Stolz, "why should we care about them?"
"Because they mean harm to Silan and we as her guardians and followers should not allow any harm to her"
Said Sieg and charged at the demons. The other three looked after him, then they quickly follwed him.
-
It was truly a sight to behold; the wretched beast towered over the landscape, making all sorts of grotesque noises. It looked as if it could rip the sky open if it raised its arms up.
But this was no time for poetic prose. Spectro needed to hide from the thing's view, because it didn't look like it was going to just stand there (plus, there was a whole profusion of demons emerging from the fissure). He ran for cover in a nearby thicket, waiting for something or someone that could be of help.
-
[Er, Blackhook, Carammel was eaten...however, if you wish to do battle with the thing that ate her... [eyebrow] ]
The four knights began to slay the daemons. Using their special abilities and great strenght, they tore away at the first wave of this vile creatures. But it was useless, the more the armored warriors slashed away at the abominations of hell itself, the more of this creatures came from within the abyss, one more groutesque than the other.
They managed to hold their own, when suddenly...
KNIGHTS ENCOUNTERED A GIANT WORM THINGY!!
*Pokemon Battle theme plays*
A giant worm-like creature appeared before the knights. Its maw drooling for the flesh of the warriors that stood before. Hungry for them, the worm shook its body, which made the corpses that made it skin, look as if they we're dancing madly.
In its disturbing excitement, the creature spun the many rings of giant teeth which it wore like a necklace. But this was not a show of the worms happyness, suddenly a few of the many teeth which adorned the worm, shot out and headded straight for the knights. And the worm continued to shoot one after another, making sure it crushes its prey.
GIANT WORM THINGY THREW ITS TEETH...ewww
------------------------------
Inside the casltle walls, the thin man began to explore this place.
"...Hello? Anyone there?...I'm looking for a job..." The man received no answer.
He wondered if he could truly find a good job in this empty retro mall.
As he ventured deeper into this structure.
-
"And lo, the Beast was not pleased with the homage and worship offered unto it; for it wanted not such things, but only to sow the seeds of destruction and rain fire upon all the land. And though the men and women continued to offer unto it worship, the Beast gave them no such mercy. And their god saw this and wept."
While all this was happening, the Darkaiser Castle continued to move. It was moving away from the site of the pit, seemingly moving towards a part of the land scarcely touched by the citizens since anyone cared to remember.
-
Nova's patience was running out with the demons, as the beast emerged from his prison, Nova looked at him, eyes flickering to him and the rest.
"I'm so glad you could all join me, ah and there is the one I praise for White-Nova" He batted an eye over to Schimmer, charging down the demons.
Sending barrage after barrage of attacks and traps, he let out a cry "Kill him, Nova, with extreme anger and prejudice!"
-
The four knights were unfased by the sudden appearance of the worm creature. Schimmer used his A-trance ability to change his form into that of Chronoforce the Xiphosuroid. In a blink of an eye all the teeth the worm shoot out were lying frozen on the ground and the worm had a dozen of huge ice icicles stucked to its body.
"Now time, REVERSE!"
After schimmer said that the icicles flught out of the worm´s body, the worm started "bleeding" strongly, but Schimmer wasn´t done.
"Now time, FAST FORWARD"
Now the icicles flew straight back at the beast, hitting it on the same spots. Schimmer -Chronoforce then repeated that attack over and over and over again, making the worm fall to the ground. Schimmer then changed his appearance again, this time he turned into Black Nova. Stolz joined her "brother" and turned into her model F form. The worm was then bombarded by the hail of fire, which was strengthened thanks to the air manipulation of ritter Sieg. Within minutes the entire worm was engulfed in a fire tornado. Ritter Sonne was staring sadly at the beast.
"Aww man,why can´t I use such attacks...I have to talk with Ms. Silan about this, the moment we find her :'("
Knights used combo move!
It was super effective
-
[INCOMING MESSAGE FROM LUCKY STAR: Don't god mod Nova. INCOMING MESSAGE FROM MIRBY: Nova, since your char and mine are just alternate versions of each other, your powers are only as strong as mine, which are still limited. Just saying this to avoid any trouble! ^_^]
Mirby reappeared and found a thicket to hide behind. Much to her surprise, the robot she had saved earlier was there too!
-
The worm was defeated...or so it seemed.
From the flamming tornado emerged the beast, it's skin burned and torn. It bled a vile ooze of purple slime which melted the ground beneat it. Its magnifecent teeth were covered in the ashes of the corpses that made the surface of it's body.
The worm shrieked at the knights, as it shot out more teeth. However, the teeth transformed into daemons.
Worm summoned its children
There were four of them, each with their own characteristics. One was tall and thin, it's arms resembled large canons. Three long horns adorned his head, on its neck a necklace of fangs.
The other was large and round, and bore long sharp claws, and talons on it's tiny feet. On its stomach, was a horrifying face of a beast. Its head was short and ulmost unoticeable, and on it's ears were to large ring shapped teeth.
The last two seemed to be twins sisters. They had four arms, two of which were on their back. They had markings on thei body, one was parallel to the other. Instead of a face, they had a large crimson eye. Compared to the other daemons, they looked more like human beings.
They readied themselves for battle, taking their stance to fight with the knights.
In the mean time, the teeth of the worm melted unto its skin and formed a shell wich it used to hide inside.
Worm used Harden/Shell
"You hurt mama..." said the thin daemon
"...Those that hurt a Royal Daemon must be punished" proclaimed the round one.
"We'll mak sure you learn your lesson throught the Era of Hell" said one of the sisters
"...Your cute" The other sister told Sieg, its pale face turned orange.
The other daemon stared at the sister in confusion.
"...Well I think he is..can I keep him as a pet after we tear him apart?" The blushing daemon asked.
"..,Sure, I get to have the female though" The thin daemon told her.
"I could go either way really." The round one stated
"I get play with the sun faced warrior, he looks like he'll make fine toy" The other sister said as she stared at Sonne.
Children of Worm used Awkward Conversation
And so the four quickly went towards the knights with great speed.
"Please do entertain us."
Children of Worm are now ready to fight!
-
[INCOMING MESSAGE FROM LUCKY STAR: Don't god mod Nova. INCOMING MESSAGE FROM MIRBY: Nova, since your char and mine are just alternate versions of each other, your powers are only as strong as mine, which are still limited. Just saying this to avoid any trouble! ^_^]
Mirby reappeared and found a thicket to hide behind. Much to her surprise, the robot she had saved earlier was there too!
[I didn't think I was, but um, alright.]
-
[Preemptive strike-type thing; Lucky was worried you might in the future, so I was just helping him out. Plus, he asked me to tell you ^_^]
-
[Alright, but tell him he should tell me himself, I won't rip him to shreds.
Though thanks for delivering the message. ^^]
Nova started waring down, his fists gradually going slower and slower
"Retreat seems best, even with White-Nova, Mirby and my power are split in half, only going 100% even with White-Nova" Nova thought, falling back as he made sure no Demons started following him.
"Fighting them now would be useless, we need more people..." Nova kept running until he found himself alone once more, the demons were being held back only a little.
"People have so many different ambitions, but what about me..." Nova pondered this as he fell onto the grass, a voice whispering into his mind
"Kill them Nova, with extreme prejudice."
-
The worm was defeated...or so it seemed.
From the flamming tornado emerged the beast, it's skin burned and torn. It bled a vile ooze of purple slime which melted the ground beneat it. Its magnifecent teeth were covered in the ashes of the corpses that made the surface of it's body.
The worm shrieked at the knights, as it shot out more teeth. However, the teeth transformed into daemons.
Worm summoned its children
There were four of them, each with their own characteristics. One was tall and thin, it's arms resembled large canons. Three long horns adorned his head, on its neck a necklace of fangs.
The other was large and round, and bore long sharp claws, and talons on it's tiny feet. On its stomach, was a horrifying face of a beast. Its head was short and ulmost unoticeable, and on it's ears were to large ring shapped teeth.
The last two seemed to be twins sisters. They had four arms, two of which were on their back. They had markings on thei body, one was parallel to the other. Instead of a face, they had a large crimson eye. Compared to the other daemons, they looked more like human beings.
They readied themselves for battle, taking their stance to fight with the knights.
In the mean time, the teeth of the worm melted unto its skin and formed a shell wich it used to hide inside.
Worm used Harden/Shell
"You hurt mama..." said the thin daemon
"...Those that hurt a Royal Daemon must be punished" proclaimed the round one.
"We'll mak sure you learn your lesson throught the Era of Hell" said one of the sisters
"...Your cute" The other sister told Sieg, its pale face turned orange.
The other daemon stared at the sister in confusion.
"...Well I think he is..can I keep him as a pet after we tear him apart?" The blushing daemon asked.
"..,Sure, I get to have the female though" The thin daemon told her.
"I could go either way really." The round one stated
"I get play with the sun faced warrior, he looks like he'll make fine toy" The other sister said as she stared at Sonne.
Children of Worm used Awkward Conversation
And so the four quickly went towards the knights with great speed.
"Please do entertain us."
Children of Worm are now ready to fight!
The four knights had a conversation during the time the Daemons had their own
"They do look kinda threatening, so are we doing a 4 vs 4 battle or do we do 1 on 1 fights?" Asked Sonne.
"1 on 1 Sonne, I take dibs on that thin one. I want his necklace :3" Proclaimed Stolz
"Pfft, how childish of you, I could just take them all out with my time stopping" Said Schimmer, who was about to change forms but got stopped by Sieg
"You should stop focusing on only one of your abilities, try to win by using your other forms and besides your elder siblings want to fight too"
Knights are ready to fight
Stolz turned into model O and slashed at the thin daemon with her O-saber, trying to behead the daemon.
Schimmer turned into Queenbee the Hymenopteroid. He then proceeded to pick up the round Daemon and fly him high into the sky.
Sieg and Sonne faced the Daemon twins.
"They look kinda cute, from a certain point of view, don´t ya agree Sieg?" Asked Sonne, who gigled and waved his hand toward the girls
"Whatever, more importantly, do you guys have names?" Asked Sieg pointing his lance at the sisters. "You are different from the mindless beasts we fought till now and I think you might be worthy opponents, so please tell me your names so I know what to write on your gravestones when I´m done with you"
Knights used counterattack!
-
The one who had saved Spectro earlier was now is the same thicket also. He went up to her.
"Hello. It seems our paths are destined to cross over and over again. Do you mind if I were to tag along with you? The lord of demons over there doesn't seem to be a very pleasant character."
-
[Ano... Could someone find Sapph and dig him out of the rubble that was once his place?]
-
Mean while in A.RPM, A.DWII, A.Afro and A.Stolz are closing in on the transdimensional machine's half in their world. They traveled for a while all over A.RPM until they arrived near a machine that was emitting the most powerful energy waves they could find. "This must be it!" A.DWII exclaimed as he read the readings his palmtop was giving him. "Ok...so we need to find out what this thing exactly does." A.Afro said examining the machine. "Yes, once we do know, we can report the findings to the master." A.DWII said as he prepared some equipment. "Er...yeah that too." A.Afro said. Damn...I need to find away to use these before the doc can give this to that mad man every one calls our master. A/Afro thought to himself but he soon noticed something on the other side. Danshu.
-
Inside the city, Nova tried to get people to prepare themselves, although it seemed useless as Nova hasn't ever done anything important.
He gave up, and went to search for Mirby "If we're the same, then I can find her..." Nova's eyes opened, startled at5 what he just realized..."Oh god thats so confusing!" Nova walked, concentrating on what that meant..."Then....shes a celestial..no...umm..."
-
The demon hardly put any effort in dodging the knights attacks.
"Are you trying to behead me? Or are you simply just fanning me?" The daemon teased.
The being slid under Stolz and blasted her from behind with one of his arm canons, sending her quite a distance away from the daemon. As his back faced the knight, he told her. "You have nice pair or undergarments, by the way." It then licked what is asumed to be his lips with his long tounge.
Thin Daemon used Panty Shot 8D
"Oh, the views quite nice up here. I always did wanted to see how the mortal world looked...shame I can only see a sea my breathren." The round daemon stated. "Oh wait no, can see two dogs fishing from here...its making me hungry." its stomach began to drool.
"Oh well, no time for that, let's spar then." The daemon curbed himself into a ball and started spinning wildly. Since the knight was holding thight to the creature, he too spun wildly in mid-air.
Round Daemon used Crazy Roller
"Well look at that sister, a man with manners. How sweet of him to ask our name...Course in a proper meeting, one tells their name first before asking the others. Not that it matters." Said the more mature sister.
"Um...hi" Said the shy daemon, hiding behind her sister's leg like a scared child.
"Venenifer, that's no way to talk to your soon to be pet, you must show him whose the boss...observe." The daemon used chains which shot out from her body to quickly tie up Sonne in a perculiar way.
"YOUR GONNA BE MY [sonic slicer] NOW, GOT THAT!?...See, easy as that." The daemon told her less aggresive sister.
Crazy Sister used Bind
"As I mentioned before, my sister's name is Venenifer. As for my own, you may call me, Viduata." She told Sieg.
"Now sister, it's your turn. SHOW HIM WHOSE GOT THE PANTS IN THIS RELATIONSHIP!!"
"Um...'k" Venenifer slowly approched Seig...and hugged him.
"..." Her cheeks blushed with an orange hue.
Venenifer used Hug...D'awwww
"Your body's quite cold...I kinda like it" And tough the knights body was indeed cold, the daemon began to sweat.
This made the knight feel a bit uncomfortable.
-
"And from the skies rained fire, and from the earth grew fire, and the inferno of the pit rose up and gathered around the people. The land became scorched by the demonic hellfire, and the Beast ruled over its terrible domain ever more."
The Darkaiser Castle found an area somewhere in the Badlands where nobody resided. It slowed its movement and sent a number of black tendrils crashing into the ground below.
-
Mirby looked at Spectro. "Yeah, sure. That is probably a good idea..." she said.
-
Meanwhile, in the ruins that had been Sapph's, Sapph himself regained conciousness, found himself incapable of moving, and severely hacked off. "Damn... I need to get outta here..." He growled, struggling a little, but not making progress. "Now let's see... How am I gonna attract attention?" He asked himself, thinking surprisingly rationally. "If I use lightning, I'll probably pass out... And I doubt anyone'll hear me if I call for help... If someone was in earshot, they'd probably think me crackers for talking to myself anyway. Hmm... Meh, I'll try the lightning." He said to himself, finally deciding what to do.
He flexed his muscles and relaxed them, continually repeating this action and picking speed to generate enough electricity. After several minutes of this, he had gathered what he felt was enough, and he was physically tired. "Hope this works..." Sapph sighed, releasing all of the electricity straight up and through the cracks in the rubble. The electricity rose several hundred feet into the air and formed the letters SOS with a line connecting to where he was.
-
"You two should better hurry up, the demons are spreading, and that guy up there is starting to get annoying with his preaching" Nova breached into Mirby's mind, feeding her his thoughts.
"I'm glad you haven't severed our ties when we took down Eden, though that makes us both weaker, too."
The town had obviously been hit somewhat, a rain was pouring, the sky here was also red, but not the crimson of where the hole was. Some of the houses were broken, either than that it was alright, no one noticing the crazy fellow doing destructive stuff.
He sat down in a restaurant, severing the call, he munched on his sandwich, his human form looking like he just returned from working in the skeleton king mines. After finishing his lunch, he set what little things he could create and set them down on the table, he walked away from the town, slamming his fist on the town's sign, on his way to where the monster was heading.
"If there's a giant floating castle and a beast smashing through towns, there ought to be someone else there fighting back."
Nova sped through town, floating an inch from the ground as he left drivers dazed from seeing a man levitating to the center of the destruction and earthquakes.
-
Stolz crushed into the ground. As she got up she was unhurt on the outside, but her ego was hurt pretty badly. It seemed that she was surrounded by a sinister aura, that made some bystanding demons tremble in fear.
"So, I guess you really want to return back to hell ,huh? Well good, because I can help you out with that! O:<"
She started rapidly firing her O-buster at the thin Daemon while she rushed towards him, hitting some bystanders in the process.
Knight chick used Rage!
"Weeee the world is spinniiiiiing yaaaaaay 8D"
Schimmer has already turned into Hedgeshock the Erinaceroid (for some reasons Schimmer felt a hunger for chilly dogs and a urge to say his name over and over again). His spinning was faster than the spinning of the round daemon so he was able to free himself from it, hurting it in the process. The he used an electric attack against the daemon
Tanuki knight used Thunderbolt!
"You think you can trap me with bonds? You think you can call me your [sonic slicer]? Ha! Let me kindly return the favor to you!"
With that Sonne´s cape changed it´s shape and turned into ropes that tied up Viduata the same way she tied up Sonne.
"Now it looks like we are eachothers bitches sha-ha-ha-ha-ha >0< oh but Sonne´s feelings go deeper that that Miss big eye Mc sado-maso"
As he said that, the ropes startedstrangling Viduata, threating to cut her appart
Psycho knight used Constrict
"Errrrm....I am really not used to this kind of situation...Sonne, what should I do?" :| Asked Sieg
"I´m ON A DATE right now!"
Sieg then started thinking about what his other siblings would do, but then he remembered that those two are immature brats who keep acting before thinking about it. He probably should not care for this demon anyway, he killed and hurt many people in his life, but then this was really akward he can´t atack unless Venenifer does anything threatening to him. In his desperation he started thinking about what Blackhook would do.
"Venenifer is a nice name err...I am Sieg by the way... '>.>"
Gentleman Knight is confused...and a virgin
-
Meanwhile, in a forest...
"...We've been walking for quite a bit haven't we?" StrangeMan asked his companions.
"I told you, we're lost...and I'm starting to get hungry. Nyyaaaar" Nekolian stomach rumbled loudly.
The two then checked on their broccoli friend, who was munching on some rocks.
"...I'm fine, just ate...want some?" The creature offered his treats.
"Er, no thanks Brocky, I can't eat rocks" Nekolian told Brocky.
StrangeMan however was all too happy to take the rocks and quickly stuffed them in his mouth.
"*crunch* *crunch* *gulp* Ah. A bit salty, but not bad."
"...How did you-" Suddenly, Nekolian noticed a strange pattern in the sky.
"...S...O...S...looks like we're not the only ones here. Come on guys!" The cyborg quickly dashed towards the source of the signal, StrangeMan and Brocky followed right behind him.
------------------------------------------------------------
The daemon dodged the blast from the knights buster, his steps made it look as if he was dancing with the wind.
"Yes, YES! OH MA~MA! I simply adore a feisty woman! Dance with me! Dance with The Wind, Ventus!" Vents shot out multiple large bullets of compressed, some of which phased right through Stolz buster shots. The two grew ever closer to each other.
Ventus dodged Stolz attack!
Ventus used Aeroblast
Though the attack hit the daemon, it did nothingto it. "Oh ho, that tickles." The daemon merely shrugged off the shock. "Now then, are we gonna play seriously now?" The round demon dad right behind the knight and clawed his back. The attack was even able to penetrate the warrior's armor.
The daemn showedit'scaws, which shined ever brightlly as it reflected the light of the nearby flames. "Be happy knight, you're going to become The Beast, Vestia's meal."
Schimmer's attack was not very effective
Vestia used Slash, it was very effective!
Viduata only laughed as the ropes grew tighter and tighter. She closed her eyelids in a way that mimicked mischievious smile.
"You really think you can pull a fast one on me? HA!! THINK AGAIN!!" Viduata's body began to crumble away, the ropes fell t tegrund. In her stead,layed millions of spiders which resembled black widow spiders.
Thespider's quickly formed back into the daemon witch. She laughed at Sonne
in amocking maner.
"You're gonna have to try harder if you wanna get a hold of The Widow, Viduata!. By the way...boom."
Sonne was a bit confused by what she meant by the word. He then noticed the chains which binded him had transformed it spiders. One of the spiders started flashing, then another, and another, until all spiders began to flash. Suddenly, all the spiders exploded with the force of nitrogen bombs.
Viduata's spiders used Self-Destruct
Venenifer continued to hold unto Sieg, her sweat began to pourunto his armor. She was ejoying this moment of sweetnes...but, her happy expression soon turned into a sad one.
"Its not fair...you're so sweet. If only I didn't have to kill you..." She muttered to the knight.
Sieg then noticed something peculiar, it bega to get hotter. When he looked down, to his horror, he saw his armor slowly melting away as the streams of the daemons sweat touched hismetal plating.
"It will all be oversoon...think of it this way, at least you died in the arms of The Poison, Venenifer...I'm sorry..."
Venenifer used Acid...still kinda cute that way she's kiling him with a hug. -w-
-
The Beast roared again, standing in the pit with its mighty body stretching out upwards, and Blackmore watched joyfully as the demonic hordes wreaed chaos below.
The castle, having fixed itself to this particular spot, proceeded to fire a beam of dark energy into the ground below, blowing a large crater into the barren wasteland floor. It slowly lowered itself down to the ground, retracted the tentacles anchoring it there, and fixed itself into the fiery crater here in the wastelands.
-
"Erg, this place sure is shaking a lot, I still haven't found a single person here, and my feet are killing me."
The thin man continued to wander around inside Darkaiser Castle.
"Wish I had a comfy chair to sit on" He though to himself. He then stumbled upon a finely crafted throne. Fit for a dark and terrifying king.
"Ah, a sit! I'm sure no one will mind if I sit down on it." Adn so he did.
The chair was comfortable, though a bit painful thanks to some of the spikes.
"...This thing needs to be re-designed."
The man took out his sketch book, and drew a silhoutte of himself, sitting on the sketch lines of a throne. He quickly finished the drawing and closed his book.
The once dark throne started to get the shape of something a bit more light hearted.
The throne now looked like a cartoonish dog, it's eyes which were connected by a spring poped out from the back rest of the sit. The arm rest we're shaped like the dog's paws.
And below the sit was the hound's mug with it's tounge sticking out. The throne can also be transformed into a reclining chair with the simple pull of a lever. Next to the lever was a cup holder for when one wants relax and drink.
And of course what throne wouldn't be complete withouth it's very own vibration system.
*Brrrrrrrrrrrrr*"A-a-a-a--a-a-a-a-a-a-h N-n-i-i-i-i-i-i-i-i-c-c-c-e-e-e."
The man then drew a television set and a remote on the same page wich had the Alpha Pop Dog Throne.
It was cruedly drawn thatnks to the vibration, but the man was satisfied.
"Now let's see what's on TV." The man saw on the light box the many daemons which tormented the outside world.
"Errg. A parade, how boring. What else is on?"
-
From behind the throne emerged Deathwatch, who had been observing the intruder's presence since he arrived. He threw his arm out and wrapped a skeletal hand around the man's neck, gripping it tightly and dragging him out of the chair and up to suitable face level.
"I don't know who you are or how you got in here," snarled Deathwatch, his eyes burning ragefully, "But I suggest you take your leave this very insant. Unless you would like me to tighten my grip and force your eyeballs out of your sockets like smashed grapes."
With his free hand he sliced a portal with his scythe, then forcibly threw the man through it, back to the outside world, and sealed it shut again. The sketch creations instantly faded and his master's throne returned to its usual form.
"The things I do in the name of evil..."
The castle, now settled firmly into the hellish wasteland, erected a large fountain of dark flames around it and numerous smaller black structures nearby it.
-
Nova looked at the castle at the distance...
"Looks a lot like Ganondorf's castle from Orcarina Of Time,weird."
-
Tai, who was far away from the chaos at that moment, was starting to get really bored. To see if he could find anything to do, he teleported to the Grasslands, unfortunately, his telporter broke somehow before he arrived to the ground and he started falling. Luckily, he fell on Lucky's ship making the fall not that bad.
"Ouch, what the hell happened" he said while holding his head in pain.
-
Cap'n, Mania and Agro were walking along looking for Afro when suddenly a portal opened above them. "Aw crap not this again!" Agro took several steps back away from the portal, only to break the fall of a thin man with a sketch book who came from a different portal behind him. "...Yup...He sure is a genetic clone of Afro." * -AC* Said Cap'n as he casual walked over with Mania. "So who are you and why are you sitting on my younger brothers clone?" he asked.
-
Lucky, seeing someone landing on his ship, immediately climbed out of the cockpit and ran onto the bow. He approached the brown-haired young man and helped him get to his feet.
"Wow, that must have been some fall you had," he said with a quaint little smile. He looked up and down at the newcomer and blinked curiously. "You look...familiar. Do I know you?"
-
"I don't know, do you? I'm sorry, I'm not that good with faces I don't see often." said Tai a bit embarassed.
-
Lucky smiled. "Well, I'm Lucky." He extended a hand. "Pleased to meet ya!"
-
Nova kept dashing through the country. There he found a demon, damaged.
"You there, explain yourself"
"Ahh, one of the messengers of god, eh?"
"We call ourselves celestial on occasions, so that would make you my main enemy."
"Indeed, but you cannot save this planet, the great beast will cause all of humanity to lose itself, grovel and pray to the beast, then they will die for disobeying God. Even when you see that people only worship what is the strongest creature."
"There are ones who swear undending loyalty, only some are cowards, I know this myself"
"So, your a man of god?"
"No, I do it with prejudice, if I want to become stronger, it starts with killing you"
Nova raised his hand, smashing it against the demon's skull, it started to glow, then dissapeared.
-
"Same here, call me Tai," said Tai as he shook Lucky's hand. After the handshake, he observed his surroundings and noticed all the chaos that was ensuing.
"So, uh, mind telling just what is happening?"
-
The thin man gazed at nothingness, for he was lost in his thoughts.
"How rude of him. Throwing people out like, doesn't he know that's bad for buisness? Hmph! That's probably why no one was around...or maybe it was a holiday. Either way, I''m never setting foot inside THAT establishment ever again."
The man snapped back into reality when he noticed he was on top of some afroed man.
"Oh, sorry for that. Some jerk wearing a cloak and lots of clocks all over him...I believe he was some hybrid of Metal and Rap."
The man stood up and dusted himself.
"Please excuse me..." The man began then began to walk away from the trio of brothers, when he realized something, and quickly came back to them.
"Excuse me for asking, but you wouldn't happen to know where a man like myself can find a job around here? I'll do anything...anything...there are some limits though."
-
Lucky shook his head. "That would be Lord Blackmore...he's sort of my arch-enemy. This is pretty normal with him around. You get used to it."
Blackmore, from atop the Beast's head, looked over into the distance and saw that his castle had taken a chunk of land in the wastelands for itself. His grin spread even further across his shadowy face as he shut the book.
"And that, dear people, is the end of that chapter. Thank you all, you've been such a wonderful audience!"
-
"Oh, so this is all Blackmore's doing then? Well, it certainly seems like something he'd do."
-
Nova trudged on, weak and tired from all his fighting and the fact he had half of his power.
The steps he took each reminded him of his conversation with the demon, he didn't know what he was fighting for.
"WHAT AM I FIGHTING FOOOOOOR!?" Nova bellowed into the sky, panting from his over emotional yell.
He kept trudging on, he could find die with pride at least. Too bad he couldn't even take another half step, he collapsed in a land with tall grass, brushing against him, luring him to rest.
-
In a room in one of those houses in the city, a boy idly messed with his fringe as he watched the news report on the latest goings on.
"Just a bunch of idiots." The boy announced, a bored look covering his face. He turned towards his dresser and looked up towards a turtle that was standing upon it. "You think so too right, Mr. Omega?"
The turtle looked annoyed. It was probably because he was named Omega. Who names a turtle Omega? Well, apparently this guy does. It's because you'd come last in a race he'd said.
"Anyway, I should go do something about this." He announced getting up from his place on the floor.
Omega's eyes clearly said that he couldn't do anything. The boy frowned.
"You know, sometimes I wished you actually talked, Mr. Omega. Then I could tell you to shut up."
-
Nova dreamed of his past, of how the whole thing with Mirby began, his human body still needed to be fleshed out so he could truly put it to good use.
His body split back into it's other forms, Min, Nova, and Ritcher. All of them flying far away, thier cores escaping the pasture.
-
So they boy ran into the city with his (unwilling) pet accompanying him on his shoulder.
And he had obtained a rake from somewhere. An old rusty rake.
"With this, I can beat anything." He declared. Omega was clearly thinking otherwise but he ignored the turtle. "There!" He said when he laid his eyes on one of the demon beasts roaming around.
"Fodder," he grinned. "My type of enemy!" He snuck up behind the demon and raised the rake.
It noticed too late.
The creature fell to the ground with the rake smashed through one side of it's head, coming out the other side.
The boy smirked evilly and Omega would've rolled his eyes. You know, if he wasn't a turtle and all.
-
The daemon dodged the blast from the knights buster, his steps made it look as if he was dancing with the wind.
"Yes, YES! OH MA~MA! I simply adore a feisty woman! Dance with me! Dance with The Wind, Ventus!" Vents shot out multiple large bullets of compressed, some of which phased right through Stolz buster shots. The two grew ever closer to each other.
Ventus dodged Stolz attack!
Ventus used Aeroblast
Though the attack hit the daemon, it did nothingto it. "Oh ho, that tickles." The daemon merely shrugged off the shock. "Now then, are we gonna play seriously now?" The round demon dad right behind the knight and clawed his back. The attack was even able to penetrate the warrior's armor.
The daemn showedit'scaws, which shined ever brightlly as it reflected the light of the nearby flames. "Be happy knight, you're going to become The Beast, Vestia's meal."
Schimmer's attack was not very effective
Vestia used Slash, it was very effective!
Viduata only laughed as the ropes grew tighter and tighter. She closed her eyelids in a way that mimicked mischievious smile.
"You really think you can pull a fast one on me? HA!! THINK AGAIN!!" Viduata's body began to crumble away, the ropes fell t tegrund. In her stead,layed millions of spiders which resembled black widow spiders.
Thespider's quickly formed back into the daemon witch. She laughed at Sonne
in amocking maner.
"You're gonna have to try harder if you wanna get a hold of The Widow, Viduata!. By the way...boom."
Sonne was a bit confused by what she meant by the word. He then noticed the chains which binded him had transformed it spiders. One of the spiders started flashing, then another, and another, until all spiders began to flash. Suddenly, all the spiders exploded with the force of nitrogen bombs.
Viduata's spiders used Self-Destruct
Venenifer continued to hold unto Sieg, her sweat began to pourunto his armor. She was ejoying this moment of sweetnes...but, her happy expression soon turned into a sad one.
"Its not fair...you're so sweet. If only I didn't have to kill you..." She muttered to the knight.
Sieg then noticed something peculiar, it bega to get hotter. When he looked down, to his horror, he saw his armor slowly melting away as the streams of the daemons sweat touched hismetal plating.
"It will all be oversoon...think of it this way, at least you died in the arms of The Poison, Venenifer...I'm sorry..."
Venenifer used Acid...still kinda cute that way she's kiling him with a hug. -w-
"Y-you think I´m scarred of wind? My brothers can control wind! And so can I"
The comressed wind blast didn´t even scratch Stolz´ armor. She has turned into model HX and all the blast Ventus sent at her simply started surronding her and soon she was enclosed in a sphere of wind. She dashed towards Vent till she was close enough. Suddenly the sphere created electric sparks and she was enclosed in a electric sphere
" Storm dress! Now I can dance with you sweetheart. My name is Stolz and I´ll be your last dance partner"
She then slammed into Vent.
Stolz used Volt tackle
Schimmer was lying on the ground, his back was hurt but there was no blood. Homunculi don´t bleed, nor do they feel pain but still he wasn´t getting up. His pride was hurt, he was always proud of the armor Silan made him he was proud enough to invade FAUST, to fight against Blackmore and Nova, yet he wasn´t able to win any of these fights and now he isn´t able to stand against this demon? Not this time, he is the guardian of the misstress if the guardian can´t defeat everyone who stands in his way how can he be a guardian? He stood up and faced Vestia.
"I am Schimmer the homunculus, we are nothing close to living beings. The only way to prove our existance is to fullfill our orders and our purpose. I f can´s do that then we are dead. I don´t want to die that´s the reason I can´t lose to you, Vestia!"
Schimmer turned into Chronoforce and slowed down time, then he changed forms again, this time into his newest form - Vestia himself!
"DNA scan completed. I wonder if beings of hell return to hell after they die"
He then slashed at the daemon, who was too slow to dodge the slash
Schimmer used mimicry
When the dust cleared Sonne was standing there, unhurt, but he was seemingly annoyed
"This is no fair, how can I cat you up when you are already made of tiny pieces? No fun, no fun at all...wait I have a great idea. Please turn again into those spiders. I will catch them all and then I will tear of their legs then I will disect the body. It´s boring with only one spider you know but I think tearing up thousand spiders will be fun"
Part of Sonne´s cape merged with his right arm and formed a buster in the shame of the sun. Sonne then fired at the Daemon
Sonne used peashooter
How unexpected, there wasn´t supposed to be any acid in the world to melt away the S-steel yet this girl´s acid was able to do so. Sieg was highly immpressed and happy. He taped Venenifer´s head
" I am sorry Venenifer, but I cannot die, there is someone I have to stay alive for, I hope your death will be painless."
Sieg created a dence wind shield around himself. The wind was able to mince Venenifer´s hands and other body parts. It was also able to destroy the acid. Sieg then proceeded to slash at the daemon with his lance.
Sieg used Letzter Wille and slash. what a jerk
-------------------------------------------------------------------------------------------------------------
Meanwhile in the alternate RPM.
Silan was communicating with someone, then she turned to A. Afro and A. DWII
"Doctor Wily, Mr. Afro. I just got the report from captain Stolz. She was able to find the criminals Flame and Roa, she was about to arrest them but she was stopped by "Mr. Afro" who reprieved them and then the three weren´t seen again."
-
From the castle's throne room, Deathwatch spread his hands apart and summoned a small window in dimensional space. His master's face appeared in it and he spoke to him.
"My lord," he declared proudly, "The Darkaiser Castle has successfully grounded itself and established its foundation upon a section of the land. The plan was a success."
"Wonderful!" cackled Blackmore with manic excitement, "Absolutely astoundingly superb!" He looked down at the Beast he was still standing upon. "Thank you kindly, my dear Beast. Your work here is done."
"No problem. It's been a pleasure doing business with ya."
With that, the Beast and his demonic horde of evil, eldritch things returned into the pit leading to The Abyss. The crater sealed itself over, leaving only a few smoldering cracks as a reminder of what had once been there. It still looked as though it could somehow be opened, though...
"And with that, I bid thee adieu! Farewell! Hyahahahahahahahahahah~"
With a tip of his hat and a swish of his cape, the devious madman vanished in a blaze of dark flames, leaving for his new castle's land.
-
Though the daemons returned to the fiery pits in which they came, The Wurm Siblings continued to fight with Silan's Knights
Stolz attack was able to hit the energetic daemon, causing a bit of damage too him.
The daemon however, just chuckled.
"Heh heh heh. Mama was right, I get to excited when facing an oponent and forget to play seriously. However, you shouldn't take the wind too lightly, girl."
Seeing as the knight was dirctly in contact with him, he aimed both his canon's at her.
A loud whirling sound could be heard from withing his limbs. He then shot out a powerful typhoon [think Storm Eagle's weapon] which not only pushed the girl away from Ventus, but was strong enough to dissapate the electric barrier around her.
The winds inside the typhoon were like thin blades piercing through her armor countless of times as it continued to push her farther and farther away.
"By the way, I'm not into Slow Dancing." The daemon continued to chuckle.
The Wind used Typhoon Blast
The round daemon was a bit suprised to see that he was facing himself. "This is intresting..." The Tanuki knight quickly slashed at Vestia, leaving a large cut on his stomach.
"I'm impressed by your shape shifting abilities. But, I'm dissapointed you decided to transform into me so early in our battle withouth knowing my true potential." Vestia opened his stomach's maw widely, and from the maw emerged dozens of tounges in the shape of long arms. The arms grabbed the knight and flung him into the air. He was thrown in a way that he would spin around as he ascended into the sky.
Vestia jumped and followed Schimmer in pursuit. As the knight spun, slashed away, making sure he cut the warrior's wound deeper and deeper.
"Humonculus, if you're going to fight an oponent as strong as myself, you better know his abilities very well. That is, if you want to defeat him."
The Beast used Triple Slash
Viduata's expression was an unpleasant one [mostly because she uses her large eyelids to express them]
"Hmmm, so explosion don't do anyhting to you?...HOW ANNOYING!! I was hoping to make this fight quick." She let out a big sigh.
Before the shot could even phase her, she crumbled a part of her body back into the same shape as the buster shot. It passed right through her.
"Now then, HOW am I going to kill you?"
She then looked at her brother's, Vestia, direction.
"...It seems like there is something that might harm you." Her eyelids mimicked an evil smile again.
"Good thing I left one more spider just incase that attack wouldn't work."
Sonne didn't notice, but there was one spider still inside his armor. Like it's brethren, it flashed just before it would explode. Unlike his brethren, it instead transformed into a large shard of material, similar to the one of Vestia's claws. It pierced through the knight's armor from within. The material quickly disentigrated, leaving a large chink in Sonne's armor, and a deep wound.
The Widow used a Dirty Trick the [sonic slicer]
Venenifer was merely a torso with a head, her limbs merely shredded meat. She began to cry, but it wans't from pain, nor was it from sadness.
"I'm happy to meet a man as kind as you, making sure I die a painless death. It's real sweet." Her face blushed once again.
"But that setimentality will be the death of you." She oponed her eye as wide as she could. Her tears became stream of acid. Her attack pushed her away from the slash, and continued melting Sieg's armor, droplets of the acid burn away bits of his face [or helmet, I don't if he still wears a helmet].
After distancing herself, she stopped the stream of acid and regenerated her limbs.
"Have some backbone and come at me with all you might! Don't show any mercy just because I'm not like my brethren!" She shouted at the knight, scolding him like a mother.
The Poison used Scold. I hope you learned your lesson, boy.
-
As Stolz was pushed farther and further back she started thinking.
/Why? Why? My body, my streangth, is it not invincible? This whole time I thought I can defeat anyone and anything, I thought to be the strongest of Silan´s knights, then why? Why couldn´t I defeat and kill the afroed man? Why was I defeated by Blackhook? Why can´t I kill this demon!?/
Stolz´ eyes started glowing red and she was surrounded by a strong sinister aura.
/I was always cocky and impulsive, never thinking before fighting, mocking my opponents, never fighting with my full strength. I have to abadon this self and become a worthy guardian of misstress Silan!/
Her armor started changing again, this time into a form she never used before, a form of the combined models once used by her original Soulanimal, but Stolz´ combined model looked differently from that of Soul, which was unusual since the other models look exactly like they looked on Soul.Within seconds she dashed trough the windblast and stopped in front of Ventus. With one slash of her beamsaber (which looked like the O and Z saber combined) she cut of Ventus´ buster arms. Then the saber dissappeared and on her hands appeared busters (On the left hand the O-buster combined with the FX gun, on her right hand the Z-buster combined with the second FX gun). She pinted them at the daemon and started mercinlessly firing at him at point black range, blowing away parts of his body till only his head remained which fell on the ground. Stolz looked down and pointed her gun at it.
"It´s silent, the music stopped playing, after they finish their dance the partners are supposed to bow to each other in gratitude and respect, it was a pleasure Ventus the Wind"
She pulled her trigger for the last time in the battle. Ritter Stolz then reverted to her regular form and fell down to the ground.
Ventus can no longer fight. Stolz is victorious!
Schimmer had deep scratches all over his body, he was barely able to move let alone dodge Vestia´s attacks. There was only one way for Schimmer to win. Vestia slashed Schimmer one more time, sending him fly even higher, this was the chance! Schimmer turned into Chronoforce.
"Sorry Sieg, I guess I´m still not strong enough. FREEZE OH TIME!"
It was quiet, everything stopped moving except for Schimmer. His time stop can last for 6 seconds max. He changed forms and turned into Nova. This change consumed too much energy, the time stop was shortened in half. But this was enough time for him.He was falling down. With his last strength he created a fireball in his hands and as he was falling past Vestia, he put the ball into his mouth. As he was some 5 metres below Vestia, time has resumed.
Vestia was surprised by the sudden disappearance of his opponent. He lookd around and saw Schimmer falling down. Then he noticed the fireball inside his mouth, but it was too late. The ball detonated and unleashed a strong enough blast that was able to tear the daemon into tiny piece which got scaterred in the air.
Schimmer was looking at the ground.
"I am not afraid, though there was someone able to penetrate and damage me, I still believe in misstress Silan. This homunculus she made won´t be destroyed by this mere ground."
He then crushed into the ground. As the dust cleared Schimmer could be seen lying on the ground. He wasn´t moving
Vestia can no longer fight. Schimmer is victorious
Sonne was crouching on the ground, he wasn´t able to stand up anymore
"This isn´t fair! This isn´t fair! NOT FAIR!" He kept yelling
"A sour loser, aren´t we?" said Viduata mockingly.
"Sha-ha-ha-ha-ha-ha-ha-ha-ha! That´s not it! I finnaly found someone who was able to damage me this badly, yet, I don´t feel pain! Why? I wanted to experience it but I simply am not allowed! SHA-HA-HA-HA-HA!" One eye on Sonne´s mask (which are always squinty) opened wide and his grin grew even wider. He looked more grotesque than usual.
" I can´t feel pain, nor do I feel fear that´s why I will make you experience these feelings for me, OK?"
Viduata has noticed to late that Sonne´s cape was getting closer to her. The cape then trapped the Widow inside an Iron Maiden, which had the same exact face as Sonne. The Iron maiden was shrinking, slowly crushing anything that was inside it. Viduata tried to prirce trought the cape the same way she did earlier Sonne, but the holes she was able to create have closed before she could escape.
"Is the enclosing darkness scarring you and now you are trying to escape to the light? I am sorry but the light of the sun doesn´t want to see you fugly oneeyed face ever again!"
Squishing sounds and screams could be heard from inside the maide, untill the maiden has become tottaly flat, then the noices stopped. The only thing that could be heard was Sonne´s maniac laugh
Viduata can no longer fight. Sonne is victorious
Sieg generated another shield, getting rid of the acid.
" Very well then, we shalt not meet again so let me show you my true self"
Sieg threw his helmet to the ground, revealing his face taht looked exactly like Blackhook´s face, but it was paler, his hair was a bit longer and it was snow white. His eyes were purple.
He held his lance above him and started swirling it. He then dashed towards Venenifer. The next second he was already standing behind her.
"You taught me a leasson, I have to thank you, I hope you will be able to meet your siblings wherever you go now."
The Poison looked happy, there was only a single tear in her eyes. Sieg´s attack took effect and the Daemon was teared appart by a growing wind sphere that Sieg created inside her body. The only thing left from her was an acid drop on Sieg´s face, that created a small scar. This way he will never forget her.
Venenifer can no longer fight. Sieg is victorious. How sad
(Sorry that I had to end it Jestah, hope you don´t mind but it seemed that Lucky wanted to end the demon arc. It was fun let us repeat it some time later)
-
[Oh, um, no, I was just wrapping up Blackmore's scheme is all. Keep going if you want.]
-
The thin man gazed at nothingness, for he was lost in his thoughts.
"How rude of him. Throwing people out like, doesn't he know that's bad for buisness? Hmph! That's probably why no one was around...or maybe it was a holiday. Either way, I''m never setting foot inside THAT establishment ever again."
The man snapped back into reality when he noticed he was on top of some afroed man.
"Oh, sorry for that. Some jerk wearing a cloak and lots of clocks all over him...I believe he was some hybrid of Metal and Rap."
The man stood up and dusted himself.
"Please excuse me..." The man began then began to walk away from the trio of brothers, when he realized something, and quickly came back to them.
"Excuse me for asking, but you wouldn't happen to know where a man like myself can find a job around here? I'll do anything...anything...there are some limits though."
"Hm...good question. Tell you what, we could help you find a job if you help us find our brother." Cap'n told the thin man, "But um...what's your name?"
Meanwhile in the alternate RPM.
Silan was communicating with someone, then she turned to A. Afro and A. DWII
"Doctor Wily, Mr. Afro. I just got the report from captain Stolz. She was able to find the criminals Flame and Roa, she was about to arrest them but she was stopped by "Mr. Afro" who reprieved them and then the three weren´t seen again."
"What the?" Afro exclaimed. "I was with you and the Doctor this whole time." Hm...Something isn't right here. The Duplicator once tried to duplicate me but that ended in failure and nearly took out the whole city.* Who could this 'Afro duplicate' be? He thought to himself.
*Refer to A.RPM Adventures issue 16, "Enter the Duplicator or One AfroMan too many"
-
"What the?" Afro exclaimed. "I was with you and the Doctor this whole time." Hm...Something isn't right here. The Duplicator once tried to duplicate me but that ended in failure and nearly took out the whole city.* Who could this 'Afro duplicate' be? He thought to himself.
*Refer to A.RPM Adventures issue 16, "Enter the Duplicator or One AfroMan too many"
"Well sir what should we do? Not only are the fugitives Flame and Roa still free but also there is this "other you" who can surely cause some major problems..."
-
"Well we need to figure out this first, before more RPM citizens disappear on us." A.Afro said but as he turned around the corner of the rather large mysterious machine, he bumped into Danshu. "Ah crap not another new villain." Danshu slowly looked down at A.Afro and then upruptly spoke out," I must not allow any one to interfere with this machine. Leave now or I will take further actions." His voice was cold and emotionless.
-
A.Silan followed A.Afro and was also surprised by the presence of Danshu
" Who are you tin man? Who sent you here? Speak if you don´t want to be melted!"
-
"I am Danshu...creation of Afro-Shroom and Jasmine...protector of this transdimensional machine and awaiting Afro-Shrooms return." He then took a MvC Ironman stance, "I have been ordered to protect this machine..." B(
-
[@Blackhook: Ah don't worry, I was kinda getting tired of writing so much every hour or so (I was getting addicted), glad we finished it quickly. However, don't think this is the last you'll see of them ('Cause I like 'em too much. Plus I had a few attacks I still had under my sleeve for them.) For now, victory goes to Silan's Knights. Maybe we'll have a go at Round 2 in another arc...course it might possibly be in some sort of random contest or other silly event instead of an actual fight. You never know.]
And so the Wurm Siblings we're completely destroyed ad sent back into the vile entrails of the worm they call their home.
All was back to normal. The pit has closed, the sky was clear, and the deamons were safetly back in their warm home, Hell. All except for the giant worm, wich was still incased in it's shell, laying motionless.
--------------------------------------------------
The thin man looked at the afroed man, still with the same dull look in his eyes.
"My name...call me Jestah. ST Jestah!...a doodler"
-
"Hm...nice name. I'm Cap'n Afro. that's AfroMania, and that guy your still sitting on is Agro, a clone of sorts of our younger brother." Cap'n explained
-
"I am Danshu...creation of Afro-Shroom and Jasmine...protector of this transdimensional machine and awaiting Afro-Shrooms return." He then took a MvC Ironman stance, "I have been ordered to protect this machine..." B(
A.Silan looked at A. Afro
"Sir, this is your creation?"
[@Blackhook: Ah don't worry, I was kinda getting tired of writing so much every hour or so (I was getting addicted), glad we finished it quickly. However, don't think this is the last you'll see of them ('Cause I like 'em too much. Plus I had a few attacks I still had under my sleeve for them.) For now, victory goes to Silan's Knights. Maybe we'll have a go at Round 2 in another arc...course it might possibly be in some sort of random contest or other silly event instead of an actual fight. You never know.]
(Can´t wait for it since I kinda like them too. Any chances of making Fan arts of them? :D)
-
"Gah! No way, Me and Jasmine never worked on such a thing. We did have a project by a similar name back a DDL but it was terminated and was confiscated after DDL was shut down years ago." A.Afro quickly explained. "Besides this also seems to be...different from what the original looked like."
-
(Can´t wait for it since I kinda like them too. Any chances of making Fan arts of them? :D)
[You bet your ass I am! Creations like this MUST be seen by the world. Amazing what you can come up with in an RP. I'll probably post it next week though.]
-
Mirby and Spectro looked up from the bush and saw the demons returning to their lair.
"That was easy..." Mirby said.
-
"Much too easy, I think," said Spectro, examining the chasm that had sealed itself. "Whoever is behind this probably has something bigger in store."
"By the way, did you see a floating castle anywhere near here? It seems to be gone now..."
-
"Let me see..." Mirby used the Scann sigil and traced the magical energies and saw the trail lowering and lowering and... "Crap. It's affixed to the badlands... It's not going anywhere else anytime soon..."
-
"Gah! No way, Me and Jasmine never worked on such a thing. We did have a project by a similar name back a DDL but it was terminated and was confiscated after DDL was shut down years ago." A.Afro quickly explained. "Besides this also seems to be...different from what the original looked like."
"So is it together with the "other Afro"? We should probably deactivate this guy and extract some information from him, what do you say?"
-
"Must be..." He approaches Danshu, "Look Danshu...it's me "Afro-Shroom". We need to head back, so abort this mission and lets get out of here." He tried to play on the fact that he looked the same that "other Afro" going around. Danshu looked at him. "Hey I think he's falling for it. Get ready-ugh!" * >^<* A.Afro was hit with a punch that threw him into a a rock, shattering it (ala DBZ style). "No one is allowed to interfere!" *O:<* Danshu had gone haywire....again.
-
"Mf. Afro! Are you okay? We´re lucky this thing is made of metal, I can control it!"
A.Silan pulled out two knives and slowly approuched Danshu
-
"Targeting....Target: Alternate RPM "Mistress Silan"...." Danshu's hand was extended at A.Silan's direction and small bright orbs appeared at the end of his fingers. Ouch...is it me or did that thing just say alternate RPM? Damn, I'l have to find out later. This is a job for Afroman. A.Afro thought to himself as he crawled out of the other side of the rock pile and quickly inverted his jacket and zipped it up revealing a large red A on in, strapped on knee guards, gloves, an over sized action scarf which covered his mouth and nose, and finally applied his sunglasses on and thus has now become his alter ego, AfroMan. Now, time for Afroman to get some answers.
Meanwhile Danshu unleashed five laser beam attacks at A.Silan aiming for her vital points.
-
" Lasers?! Damn it, I should have known"
The laser beams hit A.Silan´s clothes, but she wasn´t wearing them . She was standing next to Danshu. A. Silan was wearring a full body armor that was really similiar to the white knights armors. She slashed at Danshu´s arm with her knife
-
The knife penetrated Danshu but with out a moment to spare he quickly grabbed A.Silan by the neck and lifted her up. "Target: Alternate RPM "Mistress Silan"...action:...terminate." He began to apply pressure on her neck but suuddenly someone dashed up to him.
"Afro-PAWNCH!!!" *Think Falcon ounch...but with an Afro inplace of a falcon 8D*
Danshu was hit in the eblow, shattering it, thus releasing A.Silan as she gasped for air.
"Hey, I don't know why your here or what you've done with all of those RPM citizens, but your gonna have to answer to me now!" said Afroman "Are you ok cheif?" He asked A.Silan.
(BTW, what is A.Silan again? a police chief or the commissioner?)
-
Nova saw that the whole episode had ended.
The other two beings gathered themselves together once more, becoming Human Black Nova, where he to train his body in physical combat
"Thiss'll take a while"
-
The boy blinked still holding his bloody rake.
"It's...over already? What the heck?!" He sighed in disappointment. "...that was dumb." He stated bluntly to Omega who's face was clearly saying like you could do better. He frowned at his pet's insolent nature.
"So...now what?"
-
The man chook the hand of the brothers. "Nice to meet you all. I'll probably forget your names seconds later due to my short attention span, but it's very nice to meet you all nonetheless." Jestah told the Cap'n withouth thinking.
"So, what is it that you guys need help with? Is it art related? I hope it isn't cause I left my crayons at home."
-
Agro got up, "oof...look, we need help finding a guy named 'Afro-Shroom'."
-
"...Afro-Shroom? A mushroom with an afro?...You guys wouldn't happen to be some wierd gang of drug dealers, would you?" He asked the man, but before he could reply, the thin sketch artist continued to speak.
"Oh well, I did say I needed a job. I guess I could try drug dealing for a bit." He told himself.
-
Cap'n sighed, Mania laughed, and Agro yelled out in frustration, all at the same time, in response to Jesta's response but none the less they carried on the search for Afro.
Meanwhile in A.RPM, T.Afro was walking A.Jasmine to her place. "Oh, Afro now that you've been able to pay off your debt to Mr. D, we can move in together." She exclaimed in excitement. "Huh, yeah...um look it's been a great evening but I need to go back and...huh, pack before I can move in." And with that T.Afro hurried off to another part of A.RPM City. "Man I need to get out of this place before I start remembering my old self again." he sighed and began to walk around."Funny thought...this seems like a universe that would exist if..." T.Afro stoped and stood silent. "...gotta get out of here." he then began to run back to Danshu and the transdiemensional machine.
-
After alot of wandering, he eventually found himself where Agro and co were.
"...hello."
-
The knife penetrated Danshu but with out a moment to spare he quickly grabbed A.Silan by the neck and lifted her up. "Target: Alternate RPM "Mistress Silan"...action:...terminate." He began to apply pressure on her neck but suuddenly someone dashed up to him.
"Afro-PAWNCH!!!" *Think Falcon ounch...but with an Afro inplace of a falcon 8D*
Danshu was hit in the eblow, shattering it, thus releasing A.Silan as she gasped for air.
"Hey, I don't know why your here or what you've done with all of those RPM citizens, but your gonna have to answer to me now!" said Afroman "Are you ok cheif?" He asked A.Silan.
(BTW, what is A.Silan again? a police chief or the commissioner?)
(Yeah, she is the chief, Stolz is captain, Sonne is a prison warden, Schimmer and Sieg are bodyguards)
"Yes I am fine, his strength just surprised me, but now that he touched me I can simply defeat him"
A.Silan pointed her arm at Danshu. Sudenly his arms , legs and some parts of his armour started melting. The melted metal then wrapped itself around Danshu´s body, covering all potentially dangerous spots.
(A.Silan can just like her original manipulate every metal with her will, she only has to touch the metal once and then she can control it and everything metalic the metal touches will be controled by Siilan aswell. This is similiar how Blackhook can manipulate Air and Plants, Temnota controls Darkness, Blackhook´s greatgrandfather controls Light etc.)
-
"AHA!" Jestah thought. It was his first day working with the afroed trio, and already he had is first customer.
"Don't worry boss, I'll take care of this one." Jestah muttered to Cap'n, his back facing the man.
The artist quickly lunged his body at the child, going in or the kill. He took the child by suprise, but just before Jestah collidd with him, he stopped right in front of him.
The artist stood up straight, looked at the child in the eyes and asked:"...YOOOOOH! Welcome to 'Super Afro Brothers Drug Deals, how may I provide you with excellent service and drugs today?."
Jestah looked at the boy's hand, and complimented him. "That's a nice turtle you have there by the way, has he or she polished his or her shell recently?"
-
During Jestah's questions the boy had attempted to say "I have a name." but upon being interrupted everytime, gave up.
He frowned at the question. "If Mr. Omega wants to be polished, then he'll polish himself." He leaned forward to Jestah as if to tell him some big secret. "He's very intelligent, you see."
-
"I see. And his such a cute turtle too.~ <3" Though most people found it disturbing, Jestah winked at the turtle, as a sign of apreciation.
"Now sir, what would you like to buy on this fine day?"
-
Omega seemed pleased at being called cute.
"Well..." He lifted up the rake he'd been using to kill random demon beasts earlier, which was now covered in blood as well as an assortment of other things.
"I don't exactly need turtle polish, but something to clean this would be good."
-
"Okay~. Just wait a moment while I check our storage, 'K~" Jestah said politely.
He then bent backwards and faced his boss.
"Yo, boss, we got any cleaning utensils?" He asked Cap'n
-
(Yeah, she is the chief, Stolz is captain, Sonne is a prison warden, Schimmer and Sieg are bodyguards)
"Yes I am fine, his strength just surprised me, but now that he touched me I can simply defeat him"
A.Silan pointed her arm at Danshu. Sudenly his arms , legs and some parts of his armour started melting. The melted metal then wrapped itself around Danshu´s body, covering all potentially dangerous spots.
(A.Silan can just like her original manipulate every metal with her will, she only has to touch the metal once and then she can control it and everything metalic the metal touches will be controled by Siilan aswell. This is similiar how Blackhook can manipulate Air and Plants, Temnota controls Darkness, Blackhook´s greatgrandfather controls Light etc.)
Danshu looked at his armor, "Primary weapons 1-3, 5 and 8 decommissioned...engaging in alternate attack mode." His eyes then began to glow bright red and looked straight at A.Silan. "Watch out!" Afroman tackled A.Silan as two eye laser attacks missed her and created a rather sizable explosion along with an appropriate crater where she was standing. "Damn...this guy's to deadly to take head on!" Afroman clenched his fist and stared angrily at Danshu before realizing he was still over of A.Silan. "Oh...sorry. you ok chief? We need a plan to take this guy down." * '>.>*
"Okay~. Just wait a moment while I check our storage, 'K~" Jestah said politely.
He then bent backwards and faced his boss.
"Yo, boss, we got any cleaning utensils?" He asked Cap'n
"Er...sure, here." He picked up Agro by the scruff of his jacket. "Hey! What's the big idea?" Agro responded.
-
Danshu looked at his armor, "Primary weapons 1-3, 5 and 8 decommissioned...engaging in alternate attack mode." His eyes then began to glow bright red and looked straight at A.Silan. "Watch out!" Afroman tackled A.Silan as two eye laser attacks missed her and created a rather sizable explosion along with an appropriate crater where she was standing. "Damn...this guy's to deadly to take head on!" Afroman clenched his fist and stared angrily at Danshu before realizing he was still over of A.Silan. "Oh...sorry. you ok chief? We need a plan to take this guy down." * '>.>*
A. Silan blushed slightly.
"Yeah , I´m fine, thank you once again, I should have known that he might have weapons in his eyes. I could even close his eyes, but I am not sure how he will react to it, he might have a selfdestruct device and we cannot allow it to destroy itself and destroy the device and probably us in the process. I might overthinking it but we cannot underestimate this thing. Any ideas Mr. Afro?"
-
Sapph sighed, exhausted from putting up his SOS signal. "Well, I guess it didn't work..." He sighed, starting to pass out. The lightning SOS starting to flicker out.
-
"Hm...He seems to be directing most of his attacks towards you. It's risky but If I can get a clear shot at him from behind, we may have a chance. Can you distract him for me?" Afroman asked A.Silan while keeping an eye on Danshu still.
Meanwhile T.Afro was nearing the entry point from where he came from and saw the fight ensuing, "Ah damn it...now I gotta fix that cheap tin scraping later." He mumbled t himself.
-
"Hm...He seems to be directing most of his attacks towards you. It's risky but If I can get a clear shot at him from behind, we may have a chance. Can you distract him for me?" Afroman asked A.Silan while keeping an eye on Danshu still.
"D-distracting him? But if he hits me your debt will increase Mr. Afro"
Silan flashstepped in front of Danshuu. She pointed her arm at him and parts of his helmet melted away, covering his lef eye.
"Just in case, I can dodge one beam easily."
She then waited for the robot to attack
Sapph sighed, exhausted from putting up his SOS signal. "Well, I guess it didn't work..." He sighed, starting to pass out. The lightning SOS starting to flicker out.
Sudenly the boulders that trapped Sapph were withing minutes cut into tiny pieces. Sapph was than pulled out by a man in a samurai outfit holding two hookswords in his hands.
"Damn it, I thought it would be someone else, or atleast a pretty princess" Said the man
" I told you, you now owe me 5 bucks" Replied a woman´s voice, but there was no woman around.
"Yeah, yeah, remind me about that later...well, atleast I did something good" The man then put Sapph down.
"Yo, you ok? I want to ask you if you know a guy called Adante, or a woman called Silan or Temnota, or if you have seen a big troll called Akvavit?"
-
As soon as A.Silan mentioned his name he quickly huddled together with her, "Shhh! look I know that, and how many times to I have to tell you it's AfroMan. the Doctor is still hear and if he finds out who I am, then everything I've worked for will be lost."He whispered.
-
Sapph got to his feet, panting after he got pulled out of the rubble. "Sorry to disappoint ya, just little ol' me." He said, rolling his shoulders, several cracking sounds being heard. "Thank you for pulling me out of that situation, but I haven't met anyone by any of those names. Sorry." He sighed, wobbling a little as he dusted himself off. "Ugh... I need coffee." He groaned, looking at the far side of the structure. Fortunately, the back of it, which had the elevator, was still standing. "By the way, I am the Sapphire Knight."
-
As soon as A.Silan mentioned his name he quickly huddled together with her, "Shhh! look I know that, and how many times to I have to tell you it's AfroMan. the Doctor is still hear and if he finds out who I am, then everything I've worked for will be lost."He whispered.
"You know there isn´t a big difference between calling you Mr. Afro and Mr. AfroMan...the second name reminds me of a stupid song...and shouldn´t you be standing BEHIND the killer robot, now he is going to attack both of us"
As she said that Danshuu fired a beam at the two
Sapph got to his feet, panting after he got pulled out of the rubble. "Sorry to disappoint ya, just little ol' me." He said, rolling his shoulders, several cracking sounds being heard. "Thank you for pulling me out of that situation, but I haven't met anyone by any of those names. Sorry." He sighed, wobbling a little as he dusted himself off. "Ugh... I need coffee." He groaned, looking at the far side of the structure. Fortunately, the back of it, which had the elevator, was still standing. "By the way, I am the Sapphire Knight."
" I see, oh well, my name is Mace and this are my sisters Reft and Light." said the samurai pointing at his swords
"Stop callin us that!" A woman´s voice yelled at the man, it seemed to come from one of the swords. The sword then started shining in a bright light and withing seconds turned into two beutiful women wearring armors. they looked the same except for One was long haired and wore a mask that covered her mouth, the other had short hair and was wearring a mask that covered the upper part of her face.
"I am Subeta" Said the Long haired one
"I am Yaiba" said the other one.
-
Dnashu stared at them, "Left eye laser decommissioned, rerouting power and increasing right eye laser to 250% power increase." As the laser drew closer and closer to Afroman and A.Silan, there was probably a lot of things they could of done, like dodge it to name a few but Afroman acted on instinct and for some odd reason went head to head with the beam. "Afro-Pawnch!!!" He yelled as he punched the eye laser, both collided in a brilliant flash and both were now locked in a power struggle, the beam was slowly gaining the edge as it pushed him further back. "C-chief! change of...plan. You gotta take him out while I keep him busy." the beam pushed further and he screamed out in pain. "Hurry!"
-
Sapph covered his face when the swords changed to women. He lifted the visor of his helmet to get a better view. His face wasn't visible due to shadows hiding it. "Now that is an interesting ability." He said, putting the visor down. "It's a pleasure to meet you." The knight said, his voice giving away how tired he was. He turned towards the elevator and pressed the side of his helmet, a clicking sound like buttons being pressed could be heard. "There it is." He said, aiming a hand up towards the 3rd or 4th floor. He shot a bolt of electricity out, which, after a couple minutes, brought back a steaming hot cup of coffee and a can of spinach.
-
"Damnit Afroman!"
Silan got behind Danshu and pointed her arm at him.Danshu´s eye started sparkling and a small explosion occured from it. The laser beam stopped.
"Phew. I used the metal to stab him from inside, I think that stopped his funkctions, I just hope his memory ship isn´t damaged."
Sapph covered his face when the swords changed to women. He lifted the visor of his helmet to get a better view. His face wasn't visible due to shadows hiding it. "Now that is an interesting ability." He said, putting the visor down. "It's a pleasure to meet you." The knight said, his voice giving away how tired he was. He turned towards the elevator and pressed the side of his helmet, a clicking sound like buttons being pressed could be heard. "There it is." He said, aiming a hand up towards the 3rd or 4th floor. He shot a bolt of electricity out, which, after a couple minutes, brought back a steaming hot cup of coffee and a can of spinach.
"Well, it was nice to meet ya, but I think we have to go now. Goodbye!" Mace and Yaiba were already going away. Subeta was standing behind for a while
"Nice helmet, bye!" She said and then hurried to her siblings
-
As the laser stopped Afroman fell to his knees and held his hand. "Now that's what I call a piercing stare. He-he-ow it hurts to laugh." *>3<* He then walked over, to Dnashu and A.Silan ,"Well chief I guess I owe you one. So is this guy still gonna be able to tell us anything?" He kicked Danshu's head. "Wow, I'm impressed. I didn't imagine you'd be this good of a fighter." Afroman and A.Silan turned and saw none other then T.Afro smiling to him self. "I guess this Alternate RPM really is something after all." *bVd*
-
"Later." He said, waving with his free hand as he set the spinach can on the ground and took ahold of the cup of coffee. "Now then..." He said to himself, lifting the visor on his helmet again to drink his coffee. After downing the cup, he picked up the spinach can and launched to the coffee pot for more. "Now, to completely recharge."
-
The artist also grabbed the afroed man by his collar. He nodded his head, as way of saying thank you to his boss. Jestah straightened himself and showed the young man Agro.
"I got just what you need little boy and cute turtle. Let me introduce you to The Afro Scrubber 5000!!...plus."
Then the artist quickly took out his sketch book and drew the silhouttes of the boy, the turtle, Agro and himself. Inbetween them was a shining table. Suddenly, the table materialiazed in front of the boy and artist.
"You see this clean table~?" Jestah asked before picking up some mud on the ground. He slapped the mud and spread it all over the table.
"Now it's dirty!~...Observe as The Afro Scrubber 5000!!...plus, completely cleans and sterilizes the table.~"
Jestah threw Agro, head first, on the table and started rubbing his afroed scalp violently agaisnt it. Until he remembered he forgot something important.
"...Oh~ Silly me, I forgot to add the cleaning liquid." Jestah drew a bottle of liquid soap beside the table sketch. Instantly, the bottle appeared on the same spot as the drawing. Jestah raised Agro's head and stuffed the bottle of soap in his afro. e then continued his somewhat cruel use of Agro's hair as a cleaning utensil.
Miracoulessly, the table was spotless.
"See, no dirt or grime thanks to The Afro Scrubber 5000!!....plus~"
------------------------------------------------------------------------
We now join our strange trio of heroes: StrangeMan, Nekolian and Brocky Bulldawg heading straight for where the signal was.
"...You think the guy who made that S.O.S. thing has any food?" Brocky asked StrangeMan.
"Maybe, all I know is those rocks you gave me gave moi a bad case of indigestion." The masked man replied,holding his stomach as he followed behind Nekolian.
"By the way, Brocky, does Nekolian look a bit worried to you?"
Brocky and StrangeMan looked at the feline cyborg. Beats of sweat ran from under his helmet. His pace quickened by each step.
StrangeMan's mask changed into a sad expression. He ten looked at he broccoli mutt..who was eating thdroplets of sweat Nekolian left behind.
rocky looked at the maskd man and told him: "...I'm thirsty too..."
he trio we're cosing in on a collapsed building. In front of the buildng was a man clad in azure armor that was drinking a cup of cofee.
-
Sapph was finishing up the last cup of coffee when he spotted the unusual trio coming towards him. He shut the helmet's visor before greeting them. "Greetings travellers. Welcome to what's left of the Sapph's Colosseum Cafe. I am the Sapphire Knight." He introduced with a slight bow. "Is there anything I can help you with?"
-
We join our animals, Akamaru and his copy/clone Maru. Sweeping the floors of Sapph's Coloseum Cafe after somehow catching dinner. Thanks to some after-affects of all the fighting, the lake where they were fishing were filled with toxic fish. Once they took bites out of the fish, they were immediately knocked out. Once they had awoke, they were surprised to find themselves in maid costumes and were ordered to begin sweeping any messes as payment for being "saved". With nothing else to do, but comply, they are now stuck with what you see now.
You'd think they would have done something other than sleep, fish, and sweep...
-
Slowly, he turned to look at that rake's rather sharp point and looked at Agro's head.
Then he smirked.
-
The artist also grabbed the afroed man by his collar. He nodded his head, as way of saying thank you to his boss. Jestah straightened himself and showed the young man Agro.
"I got just what you need little boy and cute turtle. Let me introduce you to The Afro Scrubber 5000!!...plus."
Then the artist quickly took out his sketch book and drew the silhouttes of the boy, the turtle, Agro and himself. Inbetween them was a shining table. Suddenly, the table materialiazed in front of the boy and artist.
"You see this clean table~?" Jestah asked before picking up some mud on the ground. He slapped the mud and spread it all over the table.
"Now it's dirty!~...Observe as The Afro Scrubber 5000!!...plus, completely cleans and sterilizes the table.~"
Jestah threw Agro, head first, on the table and started rubbing his afroed scalp violently agaisnt it. Until he remembered he forgot something important.
"...Oh~ Silly me, I forgot to add the cleaning liquid." Jestah drew a bottle of liquid soap beside the table sketch. Instantly, the bottle appeared on the same spot as the drawing. Jestah raised Agro's head and stuffed the bottle of soap in his afro. e then continued his somewhat cruel use of Agro's hair as a cleaning utensil.
Miracoulessly, the table was spotless.
"See, no dirt or grime thanks to The Afro Scrubber 5000!!....plus~"
"...I like his style." *owob* Maniac said.
Meanwhile in A.RPM, T.Afro, now walking towards A.Afro/Afroman and A.Silan, smiled to himself. "Well If it isn't the great Afroman and the police chief." Afroman took a step back and was caught in disbelief, He and this imposter looked exactly the same!
-
A.Silan was staring in disbelief at T. Afro
"U-unbelievable, the voice, the look, now I get it how Stolz was fooled. This guy isn´t just an impostor. If we consider what the robot kept saying we can assume that this man in front of us is really YOU Mr. Afro from an alternate universe!"
She then shook her head.
"I can´t believe I said that aloud...."
-
"That's impossible! This isn't some kind of science fiction movie, that kind of technology simple can't exist!" He said in a tone of fear. "Oh but it does! You and I are clear evidence of that." He walked closer, "A.Silan...you're very much less of a pain in this RPM but your still a pain none the less!" He dashed up to her but Afroman sidestepped in front of them both. "Look, I don't care if you really are me...I want some answers and your gonna give'em to me!"
-
"I doubt he will give in the peaceful way!"
Said A. Silan and pointed her right arm at the liveless Danshu, parts of his armor broke free from it, melting together, then the liquid metal flew towards T.Afro at high speed. When it hit him, it tied his arms to his body and also tied his legs. The metal hardened instantly. T. Afro then fell to the ground.
-
"Rrr....damn!" T.Afro was seemingly trapped by Danshu's melted armor. "Alright...since you don't have anywhere to go. Now let's get down to business." he turned to A.Silan, "You wanna ask him about Flame and Roa Chief?"
As A.Silan and A.Afro began to question T.Afro, A.DWII quietly backed away and was now on his way back to Master D's Lair. "Yes sir...yes sir...no sir...yes sir, you're assumption on Afroman's identity was correct...no sir, it seems the machine is a portal to another RPM universe...yes sir, I will begin work on the confiscated D.A.N. project right away sir." A.DWII was now in his lab and began furiously working on what appeared to be a incomplete and beta version of Dan.
-
"What are your connections to Flame and Roa? What is this machine and this robot? Who are you working for?"
Asked A. Silan
---------------------------------------------------------------------------------------
Meanwhile in RPM
"Oi, oi, it seems you got quite the beating" Said Mace who found the four Silan Knights. Sieg was carrying Sonne on his back, who was tied to Sieg by his cape. Stolz and Schimmer were still uncouncious.
" It´s you, have you seen our misstres?" Asked Sieg.
"Hey Subeta, Yaiba, go please help those guys"
The two women the picked up Stolz and Schimmer.
"I thought you know where your creator is, I was also looking for her." continued Mace
-
"Ha, Those two idiots? I have no real connection to them, I just bumped into them at the bar when some rookie officer tried to arrest them. I must say your law enforcement here is quite weak, I expected more from the Alt version of Silan." He said with a wise ass smirk on his face. "As for the robot, why just ask ol' 'AfroMan' over there, he should know just as much as I do. And I only work for myself." Afroman picked up T.Afro by his collar, "What is this machine and where are the missing civilians!?" Afroman wanted some answers to all this madness and he wanted them now.
-
Nekolian jumped in front of the azure man and slammed his hands over his shoulders.
"What happened here!? Where you the one who shot that S.O.S signal!?"
Nekolian breaths were heavy, droplets of sweat continued to drop from under his helmet.
-------------------------------------
"Ah, I see you're intrested in The Afro Bubbler 5005!!...plus. You can have this product, as well as the free bottle of cleansing liquid, for the low low price of...Excuse me for a second 'K~" Jestah once agained bent towards his boss.
"What's the price of this thing? I wanna make sure I don't screw up on my first day."
--------------------------------
Meanwhile, in the Wastelands...
The shell of melted teeth began to ooze a orange liquid. More ooze began to pour from the small cracks that slowly formed on the shell.
-
Agro was flailing "H-hey! You can't just sell me for-"
"...19.95." said cap'n calmy
"...I hate you all." said Agro stubbornly.
-
"You sure? He looks like a 9.85 to me...your the boss though, so..."
Jestah stood up straight once again and looked at the smirking child.
"...it's worth the same price as what my boss said!~ We'll also include this FREE Pancakes!" The artist quickly drew a plate with a large pile of pancakes, smothered in sweet syrup, and two small slices of butter with rings of cherries around them.
"Pancakes will make you into a big boy.~" Jestah, withouth thinking of the thoughts of others, winked at the boy, as he did with the turtle.
-
"Ha, Those two idiots? I have no real connection to them, I just bumped into them at the bar when some rookie officer tried to arrest them. I must say your law enforcement here is quite weak, I expected more from the Alt version of Silan." He said with a wise ass smirk on his face. "As for the robot, why just ask ol' 'AfroMan' over there, he should know just as much as I do. And I only work for myself." Afroman picked up T.Afro by his collar, "What is this machine and where are the missing civilians!?" Afroman wanted some answers to all this madness and he wanted them now.
"Calm down Mr. Afro, let just agree that I will be the bad cop"
A. Silan snapped his fingers and T. Afro´s bonds tighteden a bit.
"Now no more smart assery and simply answer the questions!"
--------------------------------------------------------------------
In the wastelands of RPM.
"What the hell is that big thing?"
Asked Mace pointing at the giant Wurm
"A wurm, apparently"
Replied Sieg
"Wurms aren´t that big!"
Continued Mace
" A wurm, from hell, apparently..."
-
"Alright alright..." T.Afro said in a tone of annoyance. "This is simply a multidimensional device built by the DWII of my dimension and I was requested to test it. and as for your precious civilians, they must of been taken to my dimension seeing as the machine tends to have a few...hiccups still." T.Afro looked around and then said," But I must say, this dimension seems to have turned out very different from what I expected. I never expected to run into Jasmine here, let alone-" Afroman grabbed T.Afro and slammed him onto the machine. "Don't even talk to her...ever." He said as he got right into T.Afro's face. "agh...w-what's the matter? Afraid she won't be able to tell the difference between us?" * [eyebrow]*
-
"MR. AFRO, CALM DOWN!"
Silan tried to stopp Afroman from hitting T. Afro or damaging the device. She then proceeded to create a thin needle inside T.Afro´s bonds, stabbing him into his arm vein. Just a precaution, she thought to herself.
" AfroMan,there seems to be something weird about your alternate self , beside the obvious, that is bugging me. Maybe he´s hiding something in his afro, we should probably shave it."
-
Afroman dropped T.Afro and began to breath heavily, "Fine...let's see." T.Afro winced a bit at the needle in his arm but smiled to him self as he slowly got up, "Don't mess with the hair A.Silan." He then looked at Afroman. "If you really want to know everything...then go into the machine with me and find out."
-
"That would be stupid, why would he want to go there, He´s obviously planning something!"
-
"...I'll do it." Afroman responded.
"yeah, you see and-what?" A.Silan was stunned at A.Afro's decision.
"I may not get another opportunity to do this...I need to find out about what he ment about Jasmine, the D.A.N. proect and more importantly...I may be able to find a way to stop Master D once and for all before he finds away to kill me for good.*" He responded with determination.
T.Afro smiled, this was gonna be a blast to watch.
*Refer to A.RPM Adventures issue 31, "Master D and the Afro-destroyer! or Afroman's final battle?"
-
"You know that I accepted to help you and all, because Master D is insane, but still, what you are trying is madness!"
-
"That may be just what is needed to fight master D...'fight fire with fire' as some one once said." He then put his hand on her shoulder, "I know you've been with me through a lot but I won't blame you if you decide to stay here." he said with an understanding attitude. *:)*
-
" And letting you alone? In a different RPM? Your debt counter would skyrocket into unbelievable heights if it would count the damage you do in another dimmension! Besides I´ve still got here people who can watch over D"
Said A. Silan with a jokingly tone, which wasn´t usual for her
-
"Heh, I knew the police department was making the right choice when you were designated as the town's police chief." Afroman responded with a hearty smile. "Ok, obvious work related sexual tension aside, let's get going. I want to see your expresions once you get to My RPM!" *>0<* T,Afro said with a maniacally laugh but was soon interrupted by A.Silan driving the needle deeper into his arm. "OW!crazy [sonic slicer] can't even take a joke in this dimension....Let's go!" *>8|*
-
"Well, you see..." Sapph started, rubbing the back of his head. "I did send up that SOS because I was buried under some heavy stone rubble, but someone already came by and helped me out." He said, noticing Akamaru and Maru, running about and sweeping up the place while wearing maid outfits. "Now that's something you don't see every day..."
-
With that, Akamaru and Maru both turned from their perspective jobs and bowed rather courteously. Then they continued on their way to clean and reconstruct the Cafe.
-
Meanwhile in RPM, Waddle Dee was still at the school he last saw Afro at. Now a student, and finally recovered from the 'initiation', he was currently lifting weights at the school gym to help build his strength. He was lifting at a chest press machine, but was soon realizing he needed his spotter (http://img64.imageshack.us/img64/7827/vlcsnap132381.png) to help him. "X(" "..." but his spotter just stood there silent, as if he was saying 'a true warrior needs not the help to over come the simplest of obstacles'. The waddle dee flailed about as the bar fell on him, ">3<", He still had along way to go.
Back in A.RPM, Afroman and A.Silan stood behind T.Afro as he walked up to the portal leading to RPM, "You chumps ready?"
(BTW anybody know what the name of the school was where every one had to deliver a package to in the second cooking competition arc?)
-
"Don´t try anything funny, you hear?"
Replied A. Silan
" I wonder what is waiting for us on the other side?"
-
"I do too, but we can't let our guard down either. Be careful." Afroman responded. All three of them, including Dan's biometal form now tucked away on T.Afro's jacket, walked into the portal and after a blindingly flash of white light, they opened their eyes and saw before them RPM. "Heh...welcome to RPM." *bVd* T.Afro responded slyly.
Meanwhile back at A.RPM, Master D was in his private quarters when he suddenly received a message from A.DWII, "Is the D.A.N. project with my modification ready?" he asked. "No sir, there are still a few more things I need to work out in the OS and Neural connections." A.DWII responded. "Bah! Until you have had completed the modifications, don't bother me again!" he shouted and ended the conversation with A.DWII. He then opened up a new conversation with a female," I need you to follow Afroman and the police Chief Silan to this...'other' RPM. I don't care what you do to every one else but don't kill Afroman, he's my opponent. I am putting my upmost trust in you J." "Understood master D." the female recipient responded with a smirk and ended the conversation.
-
After the light has dulled A. Silan looked around
" I expected something...different...What do we do now Mr. Afro?"
-
(Er...what would you prefer? Find the missing A.RPM citizens that are causing havoc in RPM, or just over all explore RPM until we bump into Silan and her knights or something else?)
-
(The first one, it sounds more that we are actually doing something :P)
Meanwhile in Master D´s quartes
Behind Master D 4 people were standing
" I can´t believe that the Chief would do something so stupid" Said the shortest person who had a young boy´s voice
"She must have her reasons, though I can´t think of any right now" Replied another one who had a manlier voice.
"She must have been forced to do it..I bet!" This time it was a woman´s voice.
"Be quiet! All of you!" Another man with a deep voice yelled at the rest. They then stopped their little chatting.
"Master, do you think "she" will be able to handle it alone?" Asked the man with the deep voice.
-
(By she are you referring to A.Silan or 'J'?)
-
(At first to A. Silan, the last line reffers to J)
-
"You sure? He looks like a 9.85 to me...your the boss though, so..."
Jestah stood up straight once again and looked at the smirking child.
"...it's worth the same price as what my boss said!~ We'll also include this FREE Pancakes!" The artist quickly drew a plate with a large pile of pancakes, smothered in sweet syrup, and two small slices of butter with rings of cherries around them.
"Pancakes will make you into a big boy.~" Jestah, withouth thinking of the thoughts of others, winked at the boy, as he did with the turtle.
"Pancakes..." He murmured putting a finger to his lips. Omega looked at him, clearly thinking share them. He waved him off. "Yeah, yeah..."
He pulled out the requested amount. "This should cover it..?"
-
"Sigh...so this what I've been reduced to? being sold as a cleaning utensil for a measly 10 zenny and a pile of pancakes..." Agro sighed, remembering the 'good' ol' days were all he did was be a clone of Afro under Roa's control and wanted nothing more then to just surpass him.
Meanwhile in A.RPM, back at Master D's private quarters. "Yes...I am more then confident. I personal created and trained her from nothing. Not only is she my top agent but now that my assumption about Afroman's identity is true, she has one tool that none of you had against him. An emotional weakness Afroman can't fight against." He said calmly and schemeingly as he quietly grinned to him self, knowing his one true nemesis would soon fall. Back at the portal to RPM, a female clad in a futuristic, and cybornetic looking riot/ninja suit looked up at the machine and walked in.
Elsewhere in RPM, Afroman, A.Silan and T.Afro were slowly walking into town. "Well Chief, I say our first objective is to find the missing civilians. Do you have a copy of all the recent missing people reports?" Afroman asked A.Silan.
-
"Sigh...so this what I've been reduced to? being sold as a cleaning utensil for a measly 10 zenny and a pile of pancakes..." Agro sighed, remembering the 'good' ol' days were all he did was be a clone of Afro under Roa's control and wanted nothing more then to just surpass him.
"HOLD IT THERE YOU SLAVE TRADERS!"
The "deal" was interupted by a mysterious ninja, dressed in a white robe with long sleeves covering his hands from which were dangling two hangman´s knots.
Elsewhere in RPM, Afroman, A.Silan and T.Afro were slowly walking into town. "Well Chief, I say our first objective is to find the missing civilians. Do you have a copy of all the recent missing people reports?" Afroman asked A.Silan.
" Who do you think I am? Of course I have them!"
A. Silan grabbed inside her clothes (Yes, she was wearring her coat again) and pulled outa sheet of paper with faces and descriptions of the miissing on them.
"This are all the known people that went missing"
-
(I think you mean Noose, that's what the hangman knot thing is called. o3o)
Afroman skimmed the paper, reviewing some of the names, "Hm...alright we have a few names here. Mirby...Lucky..." As he rambled on with A.Silan about the missing people, The female agent known as 'J' arrived in RPM, she then contacted Master D, "Master...I've infiltrated the other RPM and currently have a signal on Afroman and the police chief." Her voice sounded distorted and computer like due to her suit. How ever there was no response, "Hm...it seems my transmission can't reach Master D..." She then turned around and examined RPM city from the view point she had arrived on. Back with Afroman and A.Silan, "Alright Chief, I think we should keep an eye out for any missing civilians from our dimension and secure this...impostor here so he doesn't sabotage us." Afroman said pointing at T.Afro. "Pff, please if anything you're the impostor here." T.Afro responded with an annoyed tone.
-
"Eh?" The boy looked towards the 'mysterious ninja'.
He blinked. "Who's this loser?" He asked, with Omega clearly thinking the same.
-
"People like you make me sick! I Whiteknot, the defender of peace, justice and morals cannot allow this barbaric doing!"
Whiteknot threw a smokebomb to the ground. After the smoke cleared the ninja was gone. But not for long, because seconds later he emeged from the ground (it seemed the the ground was liquid when he emerged from it, but when his whole body was above the ground, the earth was solid again) and was standing right behind the boy.
"Hmm..it seems you are too young,your mind hasn´t been corrupted enough I guess, so I guess I light slap should do the trick!"
The ninja than swung his noose at the boy.
Meanwhile.
A. Silan was easily irritated by T. Afro. His last remarks made her punch the back of his head really hard.
-
"I see...so no one got hurt?" Nekolian sighed in relief.
He then slapped the azure man on the back of his head.
"NYYYAAAARRRR!!! You made me worry for nothing! I thought someone might have been seriously hurt!" He told the reploid.
From behind the feline cyborg, came the caped, masquerading hero (who has yet to save anything in last series) and his dog faced friend. They were both exhausted from chasing after the paranoid man.
"*huff* *huff* Finally...caught up to you *huff* Nekolian *huff* *huff* whose you're friend who you just mercilessly slapped?" StrangeMan asked.
"...More importantly...does he have food and water?" Asked Brocky.
-----------------------------------
Jestah had a stern look on his face, or at least he tried to.
"Hey, stop badgering my customer. We're trying to do some buisness here, and at a great price no less." the artist told the white shinobi.
Out of thin air, a chair materialized behind the ninja.
"Now sit down and let us do our buisness!...'K~" Jestah said as he winked at the man.
The arm rests of the chairs suddenly came to life. The attachments grabbed the ninja and forced him to sit down.
"Now you behave!" Jestah scolded the man.
"Now then..." Jestah bagged Agro with a used plastic bag and gave the afroed man to the boy. "I hope you enjoy your Afro Scrubber 5000!!...plus, as much as you'll enjoy those pancakes.~"The artist/salesman quickly snatched the money from the boy's hand.
"I hope you come again soon~ <3" Jestah gave one final wink to the boy and turtle before bending backwards to face his boss.
"Did I do a good job on my first customer boss?"
----------------------------------
Back in the wastelands, the wurm shell cracks began to widen as more ooze poured from the said openings.
I faint screeching sound could be heard.
-
"Yep, no one was seriously-- OW!" Sapph said, getting knocked forward and almost onto his face. "Sorry to make ya worry for nothing." He said, straightening up and spotting the feline cyborg's companions. Well, I've seen stranger... Namely a moment ago. He thought, shrugging. "I am the Sapphire Knight. And as for food and water, you have a little further to travel." He said, pointing at the elevator, all the way on the other side of the massive arena that made up the lower floor of his Colosseum cafe.
-
Jestah had a stern look on his face, or at least he tried to.
"Hey, stop badgering my customer. We're trying to do some buisness here, and at a great price no less." the artist told the white shinobi.
Out of thin air, a chair materialized behind the ninja.
"Now sit down and let us do our buisness!...'K~" Jestah said as he winked at the man.
The arm rests of the chairs suddenly came to life. The attachments grabbed the ninja and forced him to sit down.
"Now you behave!" Jestah scolded the man.
"Now then..." Jestah bagged Agro with a used plastic bag and gave the afroed man to the boy. "I hope you enjoy your Afro Scrubber 5000!!...plus, as much as you'll enjoy those pancakes.~"The artist/salesman quickly snatched the money from the boy's hand.
"I hope you come again soon~ <3" Jestah gave one final wink to the boy and turtle before bending backwards to face his boss.
"Did I do a good job on my first customer boss?"
" You fiend, let me out of this! I cannot believe what you just did, RIGHT IN FRONT OF ME"
The ninja strugled to get out of the chair.
Back in the wastelands, the wurm shell cracks began to widen as more ooze poured from the said openings.
I faint screeching sound could be heard.
The group of 7 (Ok 2 were unconscious) were staring at the wurm
"That thing is creeping me out, I think we should go no"
Offered Mace
"I want to see what happens..."
Said Sieg
"Maybe it will explode in a colorful explosion"
Said Sonne
-
The boy and Omega idly watched the show as the two ate the pancakes, only pulling his eyes away occasionally to whack Agro over the head with the wooden end of the rake whenever he struggled.
-
The boy and Omega idly watched the show as the two ate the pancakes, only pulling his eyes away occasionally to whack Agro over the head with the wooden end of the rake whenever he struggled.
"OW! What the hell man!?" Agro exclaimed as the boy hit him with the rake.
Meanwhile.
A. Silan was easily irritated by T. Afro. His last remarks made her punch the back of his head really hard.
"Ack!" >^< T.Afro slupmed over and sat silent, "Oh great chief, don't tell me you've killed him...nah he's still breathing, well at least he'll be quite." Afroman said as he bent over looking down at T.Afro but he notice something about T.Afro's comb. "Hey chief, is it me or did the face on his comb change from '8D' to 'bVd'?" Moments later Afro lifted his head up, hitting Afroman in the face with the back of his skull resulting in both of them, crouching over in pain in a creepily similar fashion. "Gah! My face!" yelled out Afroman. "Gah! My head..." Afro then felt the needle in his arm,"GAH! My arm!" A.silan watched, confused for a moment at T.Afro's sudden personality change into Afro but also how He and Afroman now seemed...more similar.
-
"...Way ahead of you!" Excalimed the broccoli who made its way to the elevator as quickly as it could.
"Anyhoo. Where are we, exactly? The masked man asked Sapph.
-------------------------------------
"You pipe down! We'll get to you in a minute!" Jestah told the grumpy ninja of justice.
-------------------------------------
Back in the wastelands...
The screeching suddenly stopped. The whole area fell silent. Not a sound was made by either the wurm shell or the 7 people close to it.
Then, the shell finally cracked open, and from it emerged a ghastly beast.
The wurm had transformed into...something else.
The head was still of the same wurm, only slimmer. On top it's "head" we're four moth like antennas, all curved towards its back. On it's neck was a lion's creast, with the markings of agonized faces. It had a long, thing torso, which bared many corpses holding jewels, gold and treasures galore. The corpses had a mad expresion on them. The eye sockets and some of the mouths of said corpses were encrusted by diamonds, rubies, saphires and any other shining rock both known and unknown to man.
On it's back, it had four batlike wings, blacker than the starless night sky. It's legs were that of a chicken...yes, chicken legs. The beast had the tail of a peacock as well, representing all the magnificent colors of the treasures of the world.
It had no arms, it mearly had stumps on which two sets of teeth rings were tied upon it. there were several teeth rings around the beast, just like its wurm form.
The beast began to emit ear piercing shrieks in a rythmitic pattern.
Translation: You dare hurt an offspring of Beezlebub, You insolent pests!?
It continued to shriek, or I should say, talk with the men standing before it.
Translation: "You should pay more pay more respect to a being such as I. It matter though, for I shall devour you and send you to the burning pit of Hell to be tortured in unimaginable and groutesque ways for all eternity!!
The new born wurm flapped it's wing at grear speed. Taking flight it drew closer the the already weakend knights and samurai.
The beast didn't notice, but their was a faint rumbling sound where it stomach should be.
-
Mace turned to Sieg.
"There, you happy now? B( WE´RE GOING TO DIE!!!!"
Mace´s sisters turned back into their sword forms (dropping Schimmer and Stolz in the procces) and were caught by Mace, who then took a fighting stance. Sieg started spinning his lance and Sonne turned his cape into a big hammer.
But then...
---------------------------------------------------------------------------------------------------------------
"You pipe down! We'll get to you in a minute!" Jestah told the grumpy ninja of justice.
" HOW DARE YOU! YOU DIDN´T EVEN SAY PLEASE!" O:<
Yelled Whiteknot and trampled the ground. Then two sharp rocks formed from the ground and crushed the chair.
"UNFORGIVABLE!!!!" Whiteknot has snapped.
---------------------------------------------------------------------------------------------------------------
T.Afro slupmed over and sat silent, "Oh great chief, don't tell me you've killed him...nah he's still breathing, well at least he'll be quite." Afroman said as he bent over looking down at T.Afro but he notice something about T.Afro's comb. "Hey chief, is it me or did the face on his comb change from '8D' to 'bVd'?" Moments later Afro lifted his head up, hitting Afroman in the face with the back of his skull resulting in both of them, crouching over in pain in a creepily similar fashion. "Gah! My face!" yelled out Afroman. "Gah! My head..." Afro then felt the needle in his arm,"GAH! My arm!" A.silan watched, confused for a moment at T.Afro's sudden personality change into Afro but also how He and Afroman now seemed...more similar.
"....I think I punched him stupid...." noted A. Silan dry
-
"Ugh, great...if he forgot anything we'd be in a bit of trouble." Afroman replied wiping a bit of blood off his nose, and putting his action scarf back on. "Gah...who are you? A new clone? and what are you doing with Silan?" Afro got up, but fell to one knee, "Agh, but more importantly...what the hell is in my arm!?" ;^; Afroman and A.SIlan looked at each other, confused about what just happened to T.Afro.
-
A. Silan started panicing
"Oh my, oh my, oh my...I think I caused him amnesia or something like that, but you have to believe me, I didn´t mean to hit him..that hard...he was calling for it and and..wait he just said my name?" A. Silan seemed confused and starred at Afro
" What the hell is with him?"
-
The daemon beast rushed towards the warriors, shrieking out it's words.
Translation: PREPARE TO DIE YOU INRESPECTFUL CURS!!
It opened it's mouth as wide as it could, which happened to be big enough to swallow the warriors whole. But, the beast suddenly stopped.
It stood there in mid-air, the rumbling sounds of its stomach were loud and clear. The beast gave one short shriek.
Translation: Today just isn't my day...
From the beast emerged a large mass of barbed tentaclem wringling wildly agaisnt eachother.
The tentacles tore the beast body completely, from the inside-out. Its head fell to the ground, as the remainder of it's body scattered throught the field.
The tentacles subsided and began to shrink down. It returned to the sleeves of a dark skinned girl with a large mohawk.
The girl was covered in stomach acid which burned away at some spots of her skin and clothing. However, her skin seemed to quickly regenerate from the burns and managed to keep the girl from burning completely. The threads of her clothing were replaced by blood red strings.
"Hmmm~ That was fun. Worm stomachs sure are wierd!" She exclaimed in a happy tone.
"I got to play with a lot of friends too, they just kept coming and coming and never stopped!"
Her happy face then became a sad one.
"...But that was too good to last a long time. I killed all those friends over and over and they just stopped coming...now I'm sad." She was of course talking to herself.
She then noticed the people who stared at her.
"Hey! You guys wanna play too?" The child had a big grin on her face.
-------------------------------------
Jestah straightend himself up and glared at the shinobi.
"...fine then. PLEASE be patient and wait your turn before I decide to bring the pain unto your back end. Is that polite enough for you?...Sir~" Jestah winked at the man again. Though it was obvious the ninja was beginning to irratate the hard working artist.
-
The daemon beast rushed towards the warriors, shrieking out it's words.
Translation: PREPARE TO DIE YOU INRESPECTFUL CURS!!
It opened it's mouth as wide as it could, which happened to be big enough to swallow the warriors whole. But, the beast suddenly stopped.
It stood there in mid-air, the rumbling sounds of its stomach were loud and clear. The beast gave one short shriek.
Translation: Today just isn't my day...
From the beast emerged a large mass of barbed tentaclem wringling wildly agaisnt eachother.
The tentacles tore the beast body completely, from the inside-out. Its head fell to the ground, as the remainder of it's body scattered throught the field.
The tentacles subsided and began to shrink down. It returned to the sleeves of a dark skinned girl with a large mohawk.
The girl was covered in stomach acid which burned away at some spots of her skin and clothing. However, her skin seemed to quickly regenerate from the burns and managed to keep the girl from burning completely. The threads of her clothing were replaced by blood red strings.
"Hmmm~ That was fun. Worm stomachs sure are wierd!" She exclaimed in a happy tone.
"I got to play with a lot of friends too, they just kept coming and coming and never stopped!"
Her happy face then became a sad one.
"...But that was too good to last a long time. I killed all those friends over and over and they just stopped coming...now I'm sad." She was of course talking to herself.
She then noticed the people who stared at her.
"Hey! You guys wanna play too?" The child had a big grin on her face.
The group glared at Caramel in disbelief. Mace seemed to be shocked to most, since the knights were pretty much to strange things. It was quiet for a while but then Sonne decided to break the silence:
"Yo, young lady, you can pla....." But he was soon stopped by Sieg. Sieg and Mace then backed off some steps from the girl.
"Why me ;O;? I didn´t want to get involved with any of this!" Complaintet Mace.
"I think the were some noble reasson you had for joining the Kishin and stuff...." Replied the sword in his right hand (Subeta)
---------------------------------------------
Jestah straightend himself up and glared at the shinobi.
"...fine then. PLEASE be patient and wait your turn before I decide to bring the pain unto your back end. Is that polite enough for you?...Sir~" Jestah winked at the man again. Though it was obvious the ninja was beginning to irratate the hard working artist.
"Oh, When you ask so nicely... o~O...IT´S TOO LATE FOR THAT! You criminals make me sick! Get ready, you will now recieve your punishment!"
The earth around suddenly started shaking and the Ninja then charged at the artist with high speed. He was about to strangle Jestah with his noose, but something unexpected happened. A figure emerged from the shadow of the ninja.It was a young girl, something around 18 years old, she was normal sized and had a thin body, she had a pretty face and straigth long white hair. She was wearring an elegant gothic dress. She then looked around in confusion. Whiteknot stopped right in front of her.
" Excuse me young lady...but what in the name of the great Hayabusa were you doing in my shadow?" Asked the shinobi
The girl looked at him closely, then replied
"D-don´t be silly, why would I be doing in your shadow? I don´t even know you. XD"
"Oh, well my name is Whiteknot the white ninja of justice and zivel of earth!" The Ninja introduced himself and made some poses
" Hi, and my name is Temnota Persil, zivel of darkness... :o WAIT YOU´RE NOT SILAN!" Freaked out the girl
"Where, where am I, I was hiding in her shadow and now I am here... ;O;" She then looked around and noticed the Afro brothers. She was looking at them for some seconds and then recognized Mania
"YOU!" She yelled out and quickly hid behind Whiteknot. She was blushing.
-
"You are at what is left of my Colosseum Cafe. If you wanna know what world or planet, I don't even have the vaguest idea." Sapph replied, heading to the elevator. Fortunately, the section of the floor with the food that actually had the food was still intact, which was surprising considering that the floor was mostly made up of really thick glass.
((I think I have the schematics written out somewhere in the Map of RPM thread.))
-
A. Silan started panicing
"Oh my, oh my, oh my...I think I caused him amnesia or something like that, but you have to believe me, I didn´t mean to hit him..that hard...he was calling for it and and..wait he just said my name?" A. Silan seemed confused and starred at Afro
" What the hell is with him?"
"Hm...He seems...different. Like a new person somehow." Afroman said with intrigue as he looked at Afro. "I have an idea chief, release him from the bindings you put on earlier."
"Oh, When you ask so nicely... o~O...IT´S TOO LATE FOR THAT! You criminals make me sick! Get ready, you will now recieve your punishment!"
The earth around suddenly started shaking and the Ninja then charged at the artist with high speed. He was about to strangle Jestah with his noose, but something unexpected happened. A figure emerged from the shadow of the ninja.It was a young girl, something around 18 years old, she was normal sized and had a thin body, she had a pretty face and straigth long white hair. She was wearring an elegant gothic dress. She then looked around in confusion. Whiteknot stopped right in front of her.
" Excuse me young lady...but what in the name of the great Hayabusa were you doing in my shadow?" Asked the shinobi
The girl looked at him closely, then replied
"D-don´t be silly, why would I be doing in your shadow? I don´t even know you. XD"
"Oh, well my name is Whiteknot the white ninja of justice and zivel of earth!" The Ninja introduced himself and made some poses
" Hi, and my name is Temnota Persil, zivel of darkness... :o WAIT YOU´RE NOT SILAN!" Freaked out the girl
"Where, where am I, I was hiding in her shadow and now I am here... ;O;" She then looked around and noticed the Afro brothers. She was looking at them for some seconds and then recognized Mania
"YOU!" She yelled out and quickly hid behind Whiteknot. She was blushing.
"..." Mania took a moment to let it sink in who temnota was, but when it hit him he bursted out laughing to the point of tears. "Oh god...it's you!" >0<
-
"I'm afraid there is no time for games at this moment, child." Said a distorted voice.
Carammel's nose started to bleed, and the blood formed into a fairly large blob. Mr.Bloody stared at the battle ready warriors, a curved grin adorned his face.
"Good afternoon, fine warrior and humonculi. The blob said, tipping his white baron hat.
"I saw your performance whilst the child and I were inside that patethic worm of a daemon." The sadistic being clapped repeatedly.
"It was very thrilling. Very thrilling indeed. Though, it was a very close call for you, wasn't it? If I heard correctly, I heard you knights work for some damsel named Silan...
Suddenly, Bloody's grin became a menacing scowl.
"Let's get to the point, shall we. I'm like a child, if someone has a great toy, I want the same toy, but better.
Mr.Bloody expresion changed back into his regular, eerie smile.
"Luckily for me, I found just the toys I want."
Mr.Bloody turned to look at the remains of the Wurm Siblings:
Ventus' fang necklace, Vestia's earring, Vituada's teeth bracelate and Venenifer's fang brooch.
"Child...eat those teeth." Mr.Bloody commanded Carammel
"...I don't get it...but if you say so Mr.Bloody."
Carammel spread her arms outward, and instantly, all teeth were in her posesion.
Those with great eye sight, could have seen that she used her barbed tentacles to snatch those accessories with lightning speed.
She then swallowed all the teeth based items, in one gulp. Since she could not feel pain, it didn't really bother her a bit.
"...BLEHH! Teeths taste icky." Carammel proclaimed.
"Your probably wondering why I'm telling you all this, no? Let's just say it's been so long since I've crushed anyone's spirit, and I want to remember how it feels like."
The blob began to pulsate with a sadistic aura.
Also, this daemons entertained me. I should give them my thanks by bringing them to their full potential. I promise you, you will see us and the daemons again, some other day of course. Till then...toodles"
The bloody being went back inside the body of the girl. She then slingshot herself over the warriors, and continued to do so, even after leaving the men's sight. Will the knights heed his warning? Only the other writer will tell.
-
Mirby vanished from where ever the hell she was back to her home dimension.
-
Meanwhile in A.RPM, Master D was slumped over his desk when suddenly a message from A.DWII appeared, "Master I have nearly finished with the modifications. All that's left is to intergate the D.A.N. with you and the dimensional machine." A small figure swiftly moved towards the slumped figure of Master D, then D sat up straight. "Good doctor, If all goes well I may allow SD Gundamns to be allowed in the city again." he pressed his fingertips together and leaned back in his chair. "Doctor, have we reccieved any information from J?" D asked. "No master...we seem to have lost her signal when she went through the portal." A.DWII responded, "Fool! How are we supposed to know when to strike if we can't recieve intell from J!? Fix it now or I will take drastic manners with you. Don't tell me you've forgotten what happened to pokemon?" *bVd* "...I'll begin work on restrengthening her signal right away sir." A.DWII responded quietly and with the emotion of a man who just had his dreams crushed.
Elsewhere in RPM, Waddle Dee was in the middle of his lunch period when he suddenly realized he forgot to pack his juice box today, ":'(". Waddle Dee still had a long way to go.
-
"All right, so what do we--?"
Spectro turned to get ideas from his new friend, only to find that she was now MIA.
"Well, that's rather disappointing... Not even a 'goodbye'..."
Spectro was unsure as to where he would go now, as the flying castle was stationed in a place that he probably could not find on his own, and the chasm stopped spitting out demons, so he went out of the thicket, hoping to find someone or something that could clue him in as to what was going on.
Then, in the horizon, Spectro could see a strange blue structure. He could barely make it out, but he was certain something was there.
"Couldn't hurt my chances..." said Spectro, making his way toward the blue building.
-
Akamaru and Maru were in warp space playing chess on some chairs. God knows how they got there or the chairs for that matter. So far, it looks like Maru is winning, but Akamaru had some moves up his sleeves that could pressure Maru. Just as Akamaru was about to take Maru's Queen with a rook, they see Mirby zooming by to who knows where.
Akamaru: "Wasn't it that girl who was sleeping at the beach with that guy?"
Maru: "I don't know. I wasn't with you yet."
Akamaru: "Oh, thats right. Rook to Black Queen. This leaves it a check."
Maru: "Damn!"
Kinda makes you wonder, however, as to what happen to the cute maid outfits...
-
"I'm afraid there is no time for games at this moment, child." Said a distorted voice.
Carammel's nose started to bleed, and the blood formed into a fairly large blob. Mr.Bloody stared at the battle ready warriors, a curved grin adorned his face.
"Good afternoon, fine warrior and humonculi. The blob said, tipping his white baron hat.
"I saw your performance whilst the child and I were inside that patethic worm of a daemon." The sadistic being clapped repeatedly.
"It was very thrilling. Very thrilling indeed. Though, it was a very close call for you, wasn't it? If I heard correctly, I heard you knights work for some damsel named Silan...
Suddenly, Bloody's grin became a menacing scowl.
"Let's get to the point, shall we. I'm like a child, if someone has a great toy, I want the same toy, but better.
Mr.Bloody expresion changed back into his regular, eerie smile.
"Luckily for me, I found just the toys I want."
Mr.Bloody turned to look at the remains of the Wurm Siblings:
Ventus' fang necklace, Vestia's earring, Vituada's teeth bracelate and Venenifer's fang brooch.
"Child...eat those teeth." Mr.Bloody commanded Carammel
"...I don't get it...but if you say so Mr.Bloody."
Carammel spread her arms outward, and instantly, all teeth were in her posesion.
Those with great eye sight, could have seen that she used her barbed tentacles to snatch those accessories with lightning speed.
She then swallowed all the teeth based items, in one gulp. Since she could not feel pain, it didn't really bother her a bit.
"...BLEHH! Teeths taste icky." Carammel proclaimed.
"Your probably wondering why I'm telling you all this, no? Let's just say it's been so long since I've crushed anyone's spirit, and I want to remember how it feels like."
The blob began to pulsate with a sadistic aura.
Also, this daemons entertained me. I should give them my thanks by bringing them to their full potential. I promise you, you will see us and the daemons again, some other day of course. Till then...toodles"
The bloody being went back inside the body of the girl. She then slingshot herself over the warriors, and continued to do so, even after leaving the men's sight. Will the knights heed his warning? Only the other writer will tell.
The samurai sighed in relief, he really didn´t want to fight any possessed girls right now. The hookswords turned back to their human forms. Sieg at the other hand was standing in shock and ave while Sonne was cackling to himself.
"Sha-ha-ha, you heard that Sieg? They will return! And you can pretty sure believe what that bloody gentleman just told us, after all why would my original belying about something like that! sha-ha-ha-ha!"
"That being was the lost part of the masked man? No wonder you are a lunatic, brother...this is bad, we must find the misstress ASAP." replied Sieg
The group the headed towards the nearest town
-----------------------------------------------------------------------------------------
"Hm...He seems...different. Like a new person somehow." Afroman said with intrigue as he looked at Afro. "I have an idea chief, release him from the bindings you put on earlier."
" You sure about it? If you say so..."
A. Silan pointed her arm at Afro Shroom. The steel bindings melted into a liquid form and flew towards A. Silan. The liquid the orbed around the police chief´s waist and formed a stylish belt.
" Well, thanks to the needle he won´t be able to hurt us anyway."
------------------------------------------------------------------------------------------
"..." Mania took a moment to let it sink in who temnota was, but when it hit him he bursted out laughing to the point of tears. "Oh god...it's you!" >0<
Temnota nestled behind the ninja
"Please, stop laughing.... :'("
That made Whiteknot even more furious
"How dare you make this lady cry! UNFORGIVABLE!
The ninja pointed at the ground. Some rocks and earth formed a huge hammer. Whiteknot picked up the hammer and threw it at Afro Mania
"JUSTICE HAMMER!"
-------------------------------------------------------------------------------------------
Meanwhile inside a castle´s throne room on an unknown destination
A man was standing in front of the throne. A young woman was sitting on the throne and seemed to be focusing on something.
"Well? Have you miiiiii found them?" Asked the man with a singing voice
"Don´t disturb me now Adante, I´m trying to get all 3258 Vogels to work! I only get signel from half of them..." replied the woman
" Are you worried about you precious "toy soldiers" Silan?"
-
Afro felt the binding release him and got up massaging your arm, "Ok...what did you do to my arm and who are you?" Afro questioned. He then looked over to A.Silan, "But more importantly..." He looked around, "Stlz isn't here is she?" *O^O*
Afromania held out his hand, caught the hammer but was pushed back a bit by the momentum, as his dug his feet into the ground abit. He held the hammer in both hands and tossed it aside as it landed with a loud bang and cracked the ground beneath it as it landed. "I don't care if she cries, she brought it upon her self when she challenged me to a fight and was forced to submit." He then looked at Temnota who nested behind the ninja again, "Yup...that sure was a blast!" *>0<*
Cap'n just sighed as he face palmed, he sat down on a nearby bench and lit up another cigarette. "I wonder how we are even related..." he muttered watching the events before him unfold.
-
" You do not remember anything that happened between us minutes ago?"
Asked A.Silan
---------------------------------------------------------------------
"You should be watching your surroundings fiend!"
Maniac was too focused on laughing to notice that the ninja´s hand emerged from the ground belloew him and dragged him down. For Maniac it felt like being drawn under water. When he was under the ground to the neck down, the earth hardened again. White knot then jumped from the ground and landed before Maniac´s head. He grabbed the hammer Maniac blocked earlier.
" You are guilty of the crime of slave trading and harassment. Your punishment is death by the hammer of justice.Be glad I´ll end it like this."
Before the ninja could finish the judgement, he was stopped by his shadow tying him.
-
"Agh...I just came to a few minutes ago myself. The last thing I remember was being in the WDS (World Domination Center), being told my hair needed some combing but after I did...I just blacked out." Afro told them. "Hm...interesting it seems we may have stumbled unto something useful here chief." Afroman told A.Silan.
"Ha ha ha, I still remember-Ahg!" Mania realized he was pulled into the ground. "Well...this isn't the first time I've been neck high in solid ground." He then looked up and saw the ninja frozen in the middle of a hammer swing. "Hmph...you obviously need to know more about the people around you're protecting." He smirked as knew that temnota was behind all this.
-
Whiteknot looked at Temnota
"Zivel of darkness, what is the meaning of this?"
The girl was pointing her arms at the ninja, she had a sad look in her face.
"Please mr. Whiteknot, don´t hurt that man, I-I don´t want anyone to die because of me..again"
The ninja looked at the afroed head on the ground.
"Seems the accusation against the crime of harassment has been lifted...your punishment shall be your body being stuck in the ground...but the punishment can be lifted completely if you release the man from the bag."
-
Mania chuckled,"Please, you think I can't escape a simple trap like this?" He broke the ground around him as he free'd one hand and then the other and lifted him self off the ground. "As for Agro, he can easily get out of the bag himself, but seeing as he was an ex-copy of my brother, he seems to take on his trait's very well."
Agro heard this, "Oh yeah!? well I'll come over there and kick your ass!" He tried to get out of the bag but...he just couldn't really. "...I hate all of you." he recieved another wack on the head via wodden rake from the boy and his turtle Omega. "Stop that!" he shouted to them both but the turtle had a look on his face saying 'shut up and let me finish watching this!'
Mania then faced the ninja again," as you can see...Agro takes after our little brother quite strongly."
-
"So it was all a misunderstanding then?"
The ninja broke down to the ground
"How, how could I made such a mistake? I was about to hurt innocent..(he looked at Mania)..well almost innocent people! I think I am the one who needs to be punished..."
He then put one of his nooses around his own neck...
-
Mania saw this, yet did nothing to stop it. Cap'n on the other hand got up and began to walk, "I'll meet up with you guys later, I'm gonna go look for Afro in the city." And with that he simply walked away.
Meanwhile with Afroman and A.Silan, "Hrm...tell me...do you know anything of...alternate dimensions?" Afroman asked Afro. "Um...no not really. I did over hear DWII talking about some kind of machine but I never really listened that well to him." Afro responded. "I see...cheif, it seems we are dealing with an entirely different person. His memory, characteristics and overall attitude have changed." He looked at her for a moment. "...how hard did you hit him?" *o~O*
-
Temnota tried to stop Whiteknot from hanging himself
"...you know hanging yourself won´t change anything!"
" But I cannot do anything right, when I think I am doing something right it will just get worse, there is no need for me in this world...I am just a burden..."
"Well, you can...work as...MY BODYGUARD!" said Temnota as a last effort
"Huh?"
"Y-yeah, that way you can´t do anything wrong, just protect me and help me find a close friend of mine..." Temnota smiled
"Hmmm...I guess that might work out...Ok from today on I will work for you, lady Temnota" The ninja loosened the noose and bowed down in respect.
" HUH? You change your mind kinda fast..." the girl was confused at how easy the ninja was convinced...
meanwhile back to Afroman, A. Silan and Afro
"Wait Mr. Afro, wasn´t there something about that comb you found?"
-
"Heh, well it seems like you've found your self a hobby, babysitting." Mania said.
"Your right!" He brought out the comb he took out from Afro's hair, it had a 'bVd' face on it. "Hm...well I think we can use this to our advantage. If anything, he could help us seeing as this is his dimension." Afroman suggested.
-
Jestah just stood there the whole time. After the battle had finished, he asked the ninja and gothic young woman:
"Are you intrested in buying anything in our fine store, I'm still working you know."
He stared at the two, waiting for a response.
---------------------------------------------------------------------------------
"I see. Well we do need to eat and a place to rest. If you don't mind us stay...er camping here that is?" StrangeMan asked Sapph
--------------------------------------------------------------------------------
Far away from the knights...
"Say, Mr.Bloody? Why didn't you let me play with those guys like we do with other guys?" Carammel asked her bloodthirsty guardian.
"Because, child, killing them now wouldn't be as fun as crushing them while they're at full strenght. Breaking their creator's spirit will be oh so much sweeter." The being responded through the girl's veins
"That's just it Mr.Bloody, I don't get why you wanna do that instead of just killing them now." The girl stated.
"Child, when you get older, you'll understand that breaking ones spirit is one of those guilty pleasures that is much more satisfying than just killing them. Besides, I already said that I hate it when someone has a better toy then I." He answered cheerfully.
"...So...am I a bad toy?" She said with a sad expresion on her face.
"Don't even compare yourself to such pawns, child. Your are the queen piece of this game of chess we call life!" He said whole heartedly.
Carammel still showed the same expression.
"...What is it child?" Mr.Bloody asked with a bit of scorn in his voice.
"...I wanna be a princess" She said as she began to pout.
"Fine then, you're a princess. (What is it with female children and being a damn princess)"
Carammel grinned widely and giggled loudly at the thought.
"Anyway, we should prepare ourselfs, child. For the next few months or so, we're going to be playing "house"! Mr.Bloody said in melancholic tone.
"'K...............wait...what do you mean by that Mr.Bloody?" She asked in confusion.
"It means, Congratulations! You're going to be the mother of four beautiful daemon children!"
-
"It means, Congratulations! You're going to be the mother of four beautiful daemon children!"
(...that's gonna be one hell of a baby shower. 8D)
J tried to contact Master D in A.RPM but still couldn't reach him, "Damn...If this is not fixed soon we will miss our only chance." She looked back at Afroman and A.SIlan, thanks inpart to her helmet having a built in scope. "Hm...it seems that something has happened...this other Afro has somehow changed..." She continued to spy on them from a considerable distance.
-
"Heh, well it seems like you've found your self a hobby, babysitting." Mania said.
"Hobby? You are wrong, this is now my" *dramatic pause* Whiteknot striked a manly pose "Responsibility !"
He then grabed the confused girl and run off with her. Their destination unknow (because WK didn´t know the way...)
"Your right!" He brought out the comb he took out from Afro's hair, it had a 'bVd' face on it. "Hm...well I think we can use this to our advantage. If anything, he could help us seeing as this is his dimension." Afroman suggested.
"Help us? Do you really think can trust him just because he switched personalities? I think that is one more reason not to trust him...who am I kidding, it´s immposible reasoning with you, just do what you think is right..."
Said A.Silan
-
"Pfft, what ever." He walked off to catch up with Cap'n Afro. "Um...guys what about me?" Agro asked still trapped in the paper bag. He received another wack from the boy and the turtle. "OW! Stop hitting me!"
"Look I know this must hard for you but...I have a feeling...an instinct you could say about him this time." Afroman explained to A.Silan. "So...seeing as I got nothing better to do, I guess I could help you guys with what ever you need. you look like a lost couple in a new town." Afro joked as he rubbed his arm. "Still I don't know why but you seem...different Silan. Did you get a hair cut?" Afro asked as he observed A.Silan.
Meanwhile in A.RPM, A.DWII contacted Master D again, "Master I have successfully strengthened J's signal, we can now receive and send messages to her."
"Excellent doctor...and the D.A.N. project?"
"Nearly complete sir."
"Good doctor, now leave me be...I need to contact J." Master D ended the conversation and now attempted to contact J.
-
"Look I know this must hard for you but...I have a feeling...an instinct you could say about him this time." Afroman explained to A.Silan. "So...seeing as I got nothing better to do, I guess I could help you guys with what ever you need. you look like a lost couple in a new town." Afro joked as he rubbed his arm. "Still I don't know why but you seem...different Silan. Did you get a hair cut?" Afro asked as he observed A.Silan.
"Instinct... I see/I really should have stayed home/" She then turned to Afro
"So you know "me"? What kind of person is she?"
Asked A. Silan. Afro seemed confused about the question
-
"Er....she is always trying to sell people her special blend of metal and her knights follow her, but Stolz...she scares me." *;3;* "Um...interesting Afro..." Afroman commented.
-
"A place to sleep? Easily arranged." Sapph said to Strangeman as he entered the elevator and waited to make sure everyone else who was going to had also gotten on.
-
Meanwhile, in the A. RPM, Master D finally got through to J. "J...j. What do you have t report?" She knelt and looked away frm A.Afro, A.Silan and Afro and responded. "I have recieved a visual on Afroman and the police chief Silan. How ever it seems they may have teamed up with the Afro-shroom of this dimension. Furthur spying and observing is suggested master." She responded cold, and mechanicly. "Very Well, do not hesitate to give us the moment to strike, our plan is nearly complete andI am ready for your confirmation. D out." Master D ended the convo and then stormed out of his private quarters into the main area of his hide out. " My minions! Prepare for battle we leave soon in to the other RPM!" He laughed to him self as hundreds of ninja, robot like soldiers saluted him.
Back in RPM, Waddle Dee was joyfully skipping down the hallways, for he got a B+ on his recent exam ":)". He went out for lunch and treated himself to a few new booster packs of Yugioh TCG from anImate. It was a good day to be Waddle Dee.
-
"Er....she is always trying to sell people her special blend of metal and her knights follow her, but Stolz...she scares me." *;3;* "Um...interesting Afro..." Afroman commented.
"Oh I stopped doing that some time ago...but that is not immportant at this moment!"
The group was suprised as they suddenly heard Silan´s voice. Afroman looked around and noticed near them a small, bird shaped metalic object. It was one of Silan´s many "eyes"- the Vogel.
"Greetings"
Said the vogel with Silan´s voice
(Seriously guys, why isn´t anyone posting?)
-
(Seriously guys, why isn´t anyone posting?)
[[I'm out of ideas. :( ]]
-
[Why do you think I quit!]
-
[I don't know what was going on, so I set Nova to go train or something, we need something interesting]
-
(I thought you had some plans, mirby...well I just continue with Afro´s story...)
-
We need an RPM castlevania. with Roa as Dracula. (I mean, hes the only one who CAN do that role and GOOD.)
Also, im not posting because my REM deprived brain lacks creativity. (sleep deprivation does that, and I FEEL it.) Imma sleep some better, and come back to the thread when my creative juices flow.
-
I think the RPMvania sounds fun... I'll make Mirby return for this... in fact... hmm...
-
Sounds fine by me
-
We'll need transitionary posts though... so it doesn't just happen out of the blue.
-
Didn't Archer say he was sick of playing as Roa?
-
I says lots of things.
-
You sly dog, you.
Posted on: May 02, 2010, 10:23:24 AM
And then, from an interdimensional portal, came a horror beyond all mortal comprehension. 'Twas Ronald McGiygas, come to lay waste to all creation!
R A N R A N R U
I W I L L S I N G
T H E S O N G
T H A T E N D S
T H E E A R T H
Lucky sighed. "God damnit."
-
but den da song did not end da werld cus it wus not sung proply but den harhuhi suziemeyer wus angrie so she made da werld end cus kyon wus gey with koysumi BUT DEN LEELOUSH SHOWD UP ND GEASD HER NOT TO ND DA WERLD
"hero i am emperor make me" he seid nd den dey made him da emepr cus he wus cool BUT DEN TOYOTA BUT ON DA 0 COSTUM ND STABD HIM "y did u do this suzuki" reroush seid nd den died
"NOOOOOOOOIO L;EOPDCH" creamed nunalie cus he wus her brotha so she went niyghtmayer of nanaliy nunalie and kild him by crushn him wit her niyghtmeyer frume
"HAHHAHAHEHRHAHA PLANNED JUST AS WENT" seid sum1 and it wus.....right ugami....AND HE HAD WRITN "NANALY VEE BRITTTANYA" IN DA DESU NOTO
nd den nanlie dyd nd had sexing wit her brotha in heaven
"MURDER U JUST R" said a voice nd it was NEYAR! nd then right bloo up frum his awsum nd da werld wus saved.
-
I F E E L
...
...
H A P P Y M E A L
And yea, did Ronald McGiygas and Haruhi Suzumiya battle! A most epic duel between two cosmic horrors!
Lucky frantically looked through a bundle of sheets. "This isn't in the script!" He paused, blinked, and looked at the sheets. "Why do I even have a script?!"
-
That´s it, I´m leaving
-
Oh come on, we're just screwing around while we're waiting for someone to do something.
Unless you want me to do something...
-
I thought that was the point of the whole debate
-
wait wat
-
I thought that was the point of the whole debate
(http://img59.imageshack.us/img59/3093/1272795082106.png)
-
The debate was about to start something
-
Elsewhere, Ronald McGigyas had set up the first RPM McGiygas's restaurant.
O P E N Y O U R
M I N D A N D
Y O U R W A L L E T
Lucky just sat down on the deck of his ship and waited for something to happen.
-
why dont we start a seperate topic for RPMVania? We all like it anyway, so a thread for constant wallmeat and monsters carrying spaghetti isnt too bad an Idea.
Also, who says we need transitional posts? just make a castle pop out of nowhere and call it a day. :P
-
"Where are we...." Said RMZX.
"No clue..." Said his loving friend, Kallen.
RMZX and Kallen, both thought to have vanished, awoke in their house, only a little confused as to their whereabouts....
RMZX Checks his watch...
"Might this be a good time to wipe away what happened here?" Said RMZX.
"Yeah... might want to leave this behind us..." Said the Redhead.
The two exited their house, upon hitting a button contained on his watch, the house burst into flames. Destroying their past life... RMZX turned around and pointed a gun at Kallen's head.
"And now... Goodbye, you pathetic fake." Said RMZX in a serious, almost menacing tone.
"What? I'm not a Fake....." Said a Shocked Kallen.
Something clicked.
"Oh right... I remember now, I'm a clone. My purposes have been fulfilled, you may terminate me now." Said "Kallen", in a robotic monotone.
RMZX Shot the clone. After the shot it became a burst of energy that RMZX Absorbed. An error in absorbtion sapped RMZX of his
"I won't forget you, Kallen. The times me and you spent together were some of the greatest I ever had... Making a clone of you was a lousy way to hold your spirit with me. While it worked to some degree, I had known deep down that I had truely lost you and you were never coming back. You will always remain a part of me... Goodbye." Said RMZX, shedding a single tear.
Using a small thumb drive shaped device he opened up a portal.
"Time to go see what awaits me in another universe. I'll be back, RPM." Mentioned RMZX as he jumped into a portal, destination unknown.
-
We all like it anyway
Only if I get to be a dandy monster hunter.
-
Well, its Like RPM x Castlevania. So most of us are.
-
I want to be a well-dressed young man with a cool hat, scarf and a snarky demon that lives inside of me that manifests itself as a huge metal claw.
-
(So what happened since I left?)
-
I honestly have no idea...
-
I want to be a well-dressed young man with a cool hat, scarf and a snarky demon that lives inside of me that manifests itself as a huge metal claw.
Go for it.
Imma be... I dunno. I guess Ill see. Maybe Ill be on the bad side for once.
-
So, what, the original arc is being scrapped?
-
I dont know. people seem to think its going nowhere.
-
What arc?
-
There was an arc?
-
Castlevania style roleplay? That sounds amusing, lets all do it.
-
Wrong word, I s'pose.
-
Okay, so are we all agreed on an RPMvania rp?
Should we do it here, or set up its own topic?
-
I tink a new thread would be better...
-
you know no ones actually doing anything in this thread right
-
Hmmm good point
-
(Damn the ONE weekend I decide to not post and all you guys come on! ;3;)
Afroman looked back at A.SIlan and the vogel, "Chief, looks like we've just found this dimension's Silan."
(I agree though, a separate, Castlevania RP thread should suffice. o3o)
-
i stand corrected
-
(Yeah...the RP is kinda like a second home to me. I spend WAY too much time here. o3o)
-
Yeah, but whenever we try to start something in either this or the previous thread, it dies because you made an un toppable arc. A dedicated topic to RPMVania might be in order. (that way, this topic can also continue doing whatever randomness someone wants.) alternate stories per se. you know?
-
Yeah, a separate topic would be good I guess. I was also thinking of doing an RPM EXE, would anyone join that?
-
I was also thinking of doing an RPM EXE, would anyone join that?
Fifty times over.
-
I was also thinking of doing an RPM EXE, would anyone join that?
sure why not
-
(I'd be game for one, and about the Castlevania RP, will the castle be more SoN based or more linear like VK?)
-
Yeah, a separate topic would be good I guess. I was also thinking of doing an RPM EXE, would anyone join that?
Oh yes.
-
Yeah, a separate topic would be good I guess. I was also thinking of doing an RPM EXE, would anyone join that?
Ive had a Flame EXE since back in '07
(I'd be game for one, and about the Castlevania RP, will the castle be more SoN based or more linear like VK?)
Lol, har to say since it will be a text based RPm'd castle.
Mazelike like the recent Castlevanias. (AKA the ones that follow SotN's example)
AKA, no, not linear. well, maybe a mish mash?
-
Yeah, a separate topic would be good I guess. I was also thinking of doing an RPM EXE, would anyone join that?
Me, probably. But I've never RP'd before.
-
Lol, har to say since it will be a text based RPm'd castle.
Mazelike like the recent Castlevanias. (AKA the ones that follow SotN's example)
AKA, no, not linear. well, maybe a mish mash?
(We could also have it extend to all across Europe or something like in Bloodlines)
-
(An adventure all over Europe to find some Mcguphins that will destroy Dracula...it sounds like fun)
-
How about we have an Xbox heug castle, and RPM kicks some vampire butt while eating wallmeat?
-
(Mmmm...delicious wallmeat. ~w~)
-
Ok, now question, whos going to be the big bad here?
-
(Wait I thought Roa was gonna RP as our stand in Dracula. -3-)
-
(I thought so too BTW I will take Death)
-
(Wait I thought Roa was gonna RP as our stand in Dracula. -3-)
Yeah...no.
-
Roa is tired of being Roa. :P
-
Then how about Lucky?
-
Roa is tired of being Roa. :P
no i'm just done for real this time
you guys keep changing stuff
i've lost interest. again
-
changing stuff?
In any case, kinda your fault. you were so good that we just cant seem to do anything else anymore. 8D
Hell, we had to close the other topic! 8D
-
You´re whinning too much
-
In any case, role of Draccie is up for grabs since archer/roa/king of babylon doesnt want it.
-
Yeah...no.
;3;
In any case, role of Draccie is up for grabs since archer/roa/king of babylon doesnt want it.
Well In that case, if no one else volunteers in the next 24 hours, I'll volunteer. o3o
-
...So, is this RP dead then?
Posted on: May 04, 2010, 05:23:44 PM
[I wanna suggest an arc]
From within the vast lanscape of RPM city, there was a lone cloaked woman.
She held many posters in her hand, and a long pastebrush in the other. In the plaza, she stuck one of the posters on a wall were all can see it. She then continued her errand to stick the rest of the ads through out the city.
"Come one, come all. Join the event that shall be talked about in the world for many generations to come!
The Rockman Perfect Metropolis: Omnipotent Race of Grandiour...Yes!!
Join the grand fray, fight along the way, compete with all your might to claim the grand prize...THE CONTINENT OF RPM ITSELF!!"
-
Flame watches this person and wonders how long till she gets banhammered by the rage of an angry admin. If not, he would step in himself.
-
In small print, it was written.
"Due to the abscence of our beautifiul and sexy leader, Vixy Nyan, thanks to the dimentional rifts. This event is sponsored by multi-billionare, Mr. Shobeez. Who has single handedly persuaded the Sparkvanian Army not to envade our homeland to grow it's already powerful and large country through a challenge of skill, strenght and survival. Many of the contestants shall be Sparkvanian citizens, along with other nations of this new world, will compete to gain our land for their kingdom...So please citizens of RPM, don't let our home be taken withouth a fight.
Compete and save our land!"
-
...So, is this RP dead then?
Posted on: May 04, 2010, 05:23:44 PM
[I wanna suggest an arc]
From within the vast lanscape of RPM city, there was a lone cloaked woman.
She held many posters in her hand, and a long pastebrush in the other. In the plaza, she stuck one of the posters on a wall were all can see it. She then continued her errand to stick the rest of the ads through out the city.
"Come one, come all. Join the event that shall be talked about in the world for many generations to come!
The Rockman Perfect Metropolis: Omnipotent Race of Grandiour...Yes!!
Join the grand fray, fight along the way, compete with all your might to claim the grand prize...THE CONTINENT OF RPM ITSELF!!"
Now this sounds interesting.
-
((OOC: Flame is standing several feet away from the poster- he cant see fine print- oh wait- he has bionic eyes. I suppose he can.. But he doesn't know its there!))
Flame, seeing no wrath of the Gods, figured the Admins must be busy, and PB just might be off somewhere, high on life.
(Ugh...) Flame mumbled to himself in his head. (I really miss the days DZ was here. These messes were cleaned up real quick then...)
So he gave a great sigh, and walked over.
"Excuse me, but- WHO exactly are you..? And may I ask why you are advertising such a treasonous prize as 'handing over' the continent of RPM? I Might not be part of the "Government," ((AKA Admins and Mods)) but I sure as hell am part of the military here."
-
BTW,
Well In that case, if no one else volunteers in the next 24 hours, I'll volunteer. o3o
Any challengers?
-
In small print, it was written.
"Due to the abscence of our beautifiul and sexy leader, Vixy Nyan, thanks to the dimentional rifts. This event is sponsored by multi-billionare, Mr. Shobeez. Who has single handedly persuaded the Sparkvanian Army not to envade our homeland to grow it's already powerful and large country through a challenge of skill, strenght and survival. Many of the contestants shall be Sparkvanian citizens, along with other nations of this new world, will compete to gain our land for their kingdom...So please citizens of RPM, don't let our home be taken withouth a fight.
Compete and save our land!"
(Interesting...Say BH, still interested in the A.Silan and Afroman cross over arc?)
Edit:Still around 5-ish hours until I'll step in for the soon to be Castlevania RP. o3o
-
(Yeah sure, why not, maybe others will join along the way...)
Afroman looked back at A.SIlan and the vogel, "Chief, looks like we've just found this dimension's Silan."
"Long time no see Afro- Shroom...tell me who are your interesting companions?"
at the same time in Silan´s sparkvenian castle. Andante was holding one of the posters for The Rockman Perfect Metropolis: Omnipotent Race of Grandiour and couldn´t stop laughing.
"How wery kind of you great leader of Sparkvenia, threatening a small village, how wery evil of you miiiiii"
Silan turned to the musician.
"Not now, I am now having a conversation, be a good boy and better see if my knights and Mace have arrived. It was some time ago since my Vogels found them..."
((OOC: Flame is standing several feet away from the poster- he cant see fine print- oh wait- he has bionic eyes. I suppose he can.. But he doesn't know its there!))
Flame, seeing no wrath of the Gods, figured the Admins must be busy, and PB just might be off somewhere, high on life.
(Ugh...) Flame mumbled to himself in his head. (I really miss the days DZ was here. These messes were cleaned up real quick then...)
So he gave a great sigh, and walked over.
"Excuse me, but- WHO exactly are you..? And may I ask why you are advertising such a treasonous prize as 'handing over' the continent of RPM? I Might not be part of the "Government," ((AKA Admins and Mods)) but I sure as hell am part of the military here."
Flame´s questions were interupted by Blackhook, who wanted to find out about the competition
"Hey Mr. Flame! Are you planning to join that?"
Flame looked at the pirate captain
"What are you doing here?"
"You see, you were not the only one I saved in the desert, those people are now looking for new homes in this city, also my crew is buying some supplies so I wnt to take a look around..."
The hooked man then turned to the girl
"Say, this race won´t involve a body parts of a messiah hunt, right?"
-
The woman just stayed at the two men in silence. They couldn't really make out her face since it was covered with the hood.
She then pasted a poster on the front side of the cyborg's body and went on her way to finish her errand.
-------------------------------------
Meanwhile, near the Sparkvanian borders...
A man driving an old, banged up buggy was making his way to RPM. He wore an expensive dress suit, diamond encrusted gloves, and shoes with dolar sign belt buckles. On his head however, was a large, worn-out 10-galon hat. He had bass like lips, glowing green eyes and golden trinckets on his teeth.
"Koh Shee hee hee! How FANtastic! Little old me is about to sponser such a great (money making) event that will transcend the history of this world!" He shouted to himself happily.
"To think this would all be possible just by little all me using my FANtasticaly unmatchable charm...and a bit of "persuasion" helped too." The man said as he counted his money bills.
Behind the man was a floating eyeball, following him from a distance. The man quickly turned his head back to gaze at the eyeball.
"...GRRRR Fine then. It's thanks to your help too. BUT ALL THE MONEY WE'RE GONNA MAKE WITH THIS WILL BE ALL MINE!! GOT IT!?" The man shook his fist at the eyeball.
-
"Hey- Wait a minute!"
Flame ripped the poster off chest which she had just pasted it on, and grabbed her by the arm. or what he assumed was her arm under the cloak.
"Im afraid I just might have to take you in for questioning. you are under arrest for suspicions of plotting against the RPM Government."
A few people booed at Flame taking away the fun contest.
"All of you go back to your own business. This ones got a meeting with the mods on how exactly she plans to just 'hand over' RPM."
-
[Perhaps I SHOULD have written 'The poster was pasted on the cyborg's body]
When Flame turned back his head to face the mysterious woman. She somehow got out of his grasp and continued to put up the rest of the posters.
What the grumpy cyborg held in his hand, was what seemed to be a prosthetic arm.
-
Flame looked down at the arm, And tossed it aside.
"Ah great...."
He walked up to the woman ignoring him, smacked the posters out of her hand, and grabbed her by the chest of her cloak.
"Alright. Seems you like it rough, if you'll forgive my saying so. Now, WHO the heck are you, WHAT is your business here, and how exactly do you plan to hand over RPM?"
Also, I would say Afro has won the position of Dracula.
-
The woman just stared at him. Motionless and withouth making a single sound. Even her own breath could not be heard, but it still could be felt.
Flame then noticed the fake arm hanging on to his right shoulder. Suddenly, the arm sprang to life and slapped the cyborg. The force was strong enough to make him fall down onto the ground.
The woman proceeded to take a maker from within her cloak and she started writing somethin on the cyborg's face. She also took out a mirror and placed it next to the cyborg. She also left him a poster and circled the fine print.
After that, she picked up her posters and tools and continued to do her job, just like the persistent femme fatale that she is.
The words that were written down on Flame's face are: "Look Host Find Truth"
------------------------------------
Meanwhile, Near the bridge to RPM.
The strange, bass lipped cowpoke was quickly making his way to RPM.
-
"Long time no see Afro- Shroom...tell me who are your interesting companions?"
Afro-Shroom Looked at the vogel and then to A.Silan, "When did you learn ventriloquism?" o~O, Afro asked. AfroMan face palmed,"I think I can explain-" "I think I can do a better job." Afroman was interrupted by Model D(an) as he floated out of Afro's pocket.
Also, I would say Afro has won the position of Dracula.
(Oh...So who's going to start the Castlevania RP then? o3o)
-
(Oh...So who's going to start the Castlevania RP then? o3o)
Either you or me. If you want (as you are Dracula,) you can start it. if not, Ill do it.
-
>RPM roleplay
>Castlevania
>No Vixy
O^O ;^;
(http://lol.rockmanpm.com/artgallery/Acid/Vixy.png)
(http://lol.rockmanpm.com/artgallery/Acid/vixybelmont.jpg)
-
>RPM roleplay
>Castlevania
>No Vixy
There's an easy way to fix that =P
-
Someone said there was no Vixy? What kind of monster would say that?
-
(Wait, no one ever said there was no Vixy. O3o; Oh and Flame, I guess you can start the RP if you want to.)
-
(What will you be called anyways? Afrula? Afrocula? Dracfro?)
-
(What will you be called anyways? Afrula? Afrocula? Dracfro?)
(Hm...good point. Dracfro seems good but Will I be a stand in for the Drac himself or actually RP as Dracula?)
-
You will be stand in of course. Or you can BE Dracula. its up to you really. do what you wish with it. Personally, I vote for Afrula. XDD
Also, Okay :3
>RPM roleplay
>Castlevania
>No Vixy
O^O ;^;
(http://lol.rockmanpm.com/artgallery/Acid/Vixy.png)
(http://lol.rockmanpm.com/artgallery/Acid/vixybelmont.jpg)
Noone ever said there was no Vixy. >.>
all you needed to do was just come 'round!
Roles and such, (other than Dracula which is already decided,) will be decided in the RPMVania thread
-
Oh BTW when you start this and I am not around I want to remind you that I will be playing Death (and maybe some minor boss...like Zephyr or Malphas)
-
IT IS DONE.
http://forum.rockmanpm.com/index.php?topic=4562
-
At the entrace of RPM, the banged up buggy made it's way to the center of the city. Behind the vehicle, was a large group of people, perhaps the hired hand for this grand event.
Among them we're some Sparkvanian soldiers and other foreigners, all riding there own unique vehicles for the coming race. There were many participants, many human, some reploid. There were even some robots among them, as well as other species of intelligent creatures.
The event was soon to start, will RPM join this competition, will Flame have his questions answered, will I ever get my copies of Megamix before I go insane?
Tune in next time as we join our heroes in their epic adventures in:
Super RPM Battle & Chasing Kart TURBO!!
-
(So I take it we're giving this RP a break until RPMvania runs it's course?)
-
Until we get enough inspiration for this one...I really want to continue what you and Jestah have planned, but I´ll wait till more people join in...
-
(Ah, sounds good. owob)
-
From the bow of the Lucky Superstar, high above the skies of RPM in the Lucky Cosmos, Lucky and his confidante Alice looked at the world below.
"This is a bad idea," said Alice, ever the apparent voice of reason and foil to Lucky's rampant silliness.
"Nonsense," beamed Lucky, setting up what looked very much like an enormous megaphone at the front of the ship.
Alice sighed and returned to her book. Once the megaphone had been set up and was properly functional, Lucky cleared his throat and spoke into it.
Well, shouted would be more appropriate - loud enough for all of RPM below to hear it.
"PARTY AT MY PLACE! WHO WANTS TO COME?"
[8D]
-
J heard the message and simply shrugged.
"I wonder who that is, I bet they have one hell of a house."
-
Far to the southwest, a massive chronospatial rift opened up. From it sprung an island with a lab on it... The island seemed distorted; that's because it was. It would take a long time before the massive island and lab were fully part of this world. Mirby exited the building and looked around. "Huh, a lot has changed here... Everything seems... bigger!"
-
Meanwhile the cloaked woman has finished posting all the posters for the "Race of Grandieur" around the city of RPM. After a job well done she cleaned off her hands and gazed proudly at the work she had accomplished...or at least it would seem so if it wasn't for the fact her face was shrouded with the shade from her hood.
-
No matter where an RPM moves to or becomes, they can never get rid of....
>0< >0< >0< TEH JUNKYARD!!!!! >0< >0< >0<
And where there is a junkyard, there will always be treasure hunters literally making themselves at home, setting up shop and selling their finds to whomever demands them, all the while making themselves comfortable with whatever repairable trinkets they found and used to set up home.
Hajime sat on the rails of the watch tower, using a surprisingly intact fishing pole with a ridiculously long line leading to the murky waters below. With nothing to do since the move, he had been fishing for more junk to stash or repair for sale.
No one knew, nor seem to care, how he got here, or if anyone else were to follow, but he didn't seem to mind the ignorance as long as he had something to do in this new world of RPM...that is...until he heard a loud noise coming from the main city. Seeing it as a better waste of time than spending the day fishing out more useless junk from the river, he abandons his fishing pole and warps to the city near where the voice could be heard.
-
[Glad to have you back in the RP White-Jet!]
From the city's gates emerged dozens of vehicles that headed straight towards the central plaza of RPM.
Large trucks carrying camera equipment, make-up and lights. Along side them were Sparkvanina battle karts, driven by higly-trained soldiers of the dreaded and powerful army.
Behind them where some more foreign vehicles, one that caught the attention of the masses was a small shopping cart, filled to the brim with weapons and gadgets. On top of said cart, a muscular looking hobo with a thick and sharplooking brow. He had a proud smile on his face as he rode his "steed" into the city.
In front of all these things, was a sharply dressed man in a buggy.
Who chuckled and laughed as he made his way to the plaza.
"Kyo Ho Ho Ho Ho Ho! This race shall be a blast!" The man told himself.
-
((So guys. Seeing that RPMvania has slowed down a little(..which I think I was the cause for >.>)how about we get our creative juices flowing and bring love to this adorable little roleplay?))
-
(I'm just trying to get to Dracula for the final battle, but SOMEONE won't allow me past their character)
-
Having lost interest in the party being so loudly announced, Hajime instead turns his attention to the second attraction trying to revive the RP sequel. He had seen the flyers posted around the city, but until now hasn't been in the mood to check it out. Deciding it would be the best place to raise some money he drives his Dragon truck towards the location, hoping to sell some drinks and snacks for the passing spectators.
-
(Heck, if this starts up fully is it okay to join in? ^^; The Sake Bar needs some love too. XD )
-
(No one's stopping newcomers from joining in)
-
[I decided I might as well rejoin this. For my sake, I've modified my original post in this RP to make the Kallen I was with a clone that I have killed off, the Original Kallen is indeed dead.]
Newscast:RMZX.EXE, once a proud and wealthy man living in RPM, recently assumed to be deceased due to his house burning down, there are no witnesses of the incident and there are no bodies among the ashes.
A person jumps out of a Mysterious Portal.
A mysterious brown-haired stranger, who had witnessed (and started) the fire, walked through the woods, shedding the clothing of a wealthy man and assuming the identity of a nobody, pulling out a set of casual clothing from before those days, a normal pair of black jeans, a warm jacket, and sneakers, he then donned a pair of sunglasses and headed to the city, hoping people wouldn't remember his identity. He quickly dons a cloak to hide his face before leaving.
"Now, my life has truely ended, a new one can begin. I will admit though, that was one fun vacation." Said the stranger.
-
*Flame hangs out at his usual haunt- the Neko cafe*
-
The mysterious man approaches the nearest building, he looks up at the sign.
NEKO CAFE
He quietly walks in and has a seat.
"What can I get you, Nya?" Said the catgirl.
".....Dr. Pepper, No ice...." Muttered the Stranger
"Coming right up!" The catgirl said in a cheerful manner
The drink was quickly handed to the man, he reached for it with a hand sheathed in leather.
"I don't think I've seen you around here, you new to this place?" Questioned the Catgirl.
"Sure, you could say that." Retorted the stranger.
What do you usually go by? Asked the catgirl.
Anarchy. They call me Anarchy. Said "Anarchy"
Anarchy? What kinda stupid name is that? Like a nickname or something? Said the confused Catgirl.
-
Meanwhile near the start of the big race that for some reason will decide of the owner of RPM...or something.
A small house seemingly made of metal was positioned near the entire ruckuss. The house was heavily guarded by sparkvenianian robots and soldiers. Inside was residing the ruler of Sparkvenia - Silan ,who was waiting for the start of this race. Silan was sitting on a throne, her loyal white knights (WHo got repaired after a very epic yet pointless fight), her confidants Temnota and Andante were standing around her.
"SO let me get this straight.."
started Sieg, the leader of the white knights,
"you actually agreed with this? Why?"
Silan looked at her creation holding a half eaten chocolate in her hand (which was weird, since her mouth was always covered by her scarf). Temnota was also licking a lolipop the whole time while hiding a rather big box of candies in her shadow.
"No special reason...boredom perhaps"
She lied.
"Atlest I got my alternate self and alternate Afro to join in aswell"
Continued Silan.
"Why? Why would you make those two enter that race?"
Asked Sieg
"Just to see what they are capable of. Really, since we appeared in this new RPM I never found any good motivation.This race might be the starting point of something exciting. Since I still was able to hold my power as ruler of Sparkvenia I might aswell try something new."
Suddenly multiple screens appeared in front of her.
" Also it seems that most participants are of Sparkvenian orgin. If a sparkvenian wins, I win."
"Way to satisfy your superiority complex"
Replied Sieg.
-
(Wait, So Silan, A.Silan, A.Afro and Afro are in the race now?)
-
Nova was slowly forgetting his reason to coming to earth, dumping several coins into fountains in order to see if his wish would come true.
(+5 points to whoever got this reference)
"I wonder...who made this wishing fountain idea..." He wondered while emptying a bag of coins he had found during his time here.
-
[[Oh, wow! Incentive to draw up a character.]]
-
(Wait, So Silan, A.Silan, A.Afro and Afro are in the race now?)
(except Silan since she will be watching the race as ruler of Sparkvenia :P )
-
(Wow, it's been like a year or something since we've been here. 8D)
Afro-Shroom Looked at the vogel and then to A.Silan, "When did you learn ventriloquism?" o~O, Afro asked. AfroMan face palmed,"I think I can explain-" "I think I can do a better job." Afroman was interrupted by Model D(an) as he floated out of Afro's pocket.
After a long winded explanation Model D(an) gave, to which Afro forgot or reimagined...
"Atlest I got my alternate self and alternate Afro to join in aswell"
Continued Silan.
"Why? Why would you make those two enter that race?"
Asked Sieg
Afro-Man sneezed, "Um...cheif? How did we get talked into doing this again?" He asked.
"I'd like to know too please." * O^O* Afro asked.
Back in RPM, Waddle Dee was joyfully skipping down the hallways, for he got a B+ on his recent exam ":)". He went out for lunch and treated himself to a few new booster packs of Yugioh TCG from anImate. It was a good day to be Waddle Dee.
Dee returned to class and took notes as the class about the 12th vital pointed needed to obliterate your opponent was being discussed on the black board.
"..." He sighed and looked outside, He wondered how Afro and Dan were doing.
-
A. Silan was looking at the car which they will use for the race. A. Silan then looked at AfroMan. She wa wearing a metalic gargoyle mask.
"Didn't you hear. My altrnate self rules over this Sparkvenia, so it means that she has some control of this place, also she knows that we came from a diferent dimension so in other words we are here ilegally. She didn't throw us in jail because we promised to join this race. I'm not sure why my alternate me would want to do that but atleast we are not in prison. Also this might give us a chance to investigate."
--------
Suddenly someone knocked on the door to the classroom. The teacher opened the door, he got a letter. The teacher then said to the whole class.
"Students let me introduce to you your new classmate, please introduce yourself."
Suddenly a large green hulking monster that barely resembled a human enterred the classroom..or rather crashed trough the wall since the door was too small.
"Hmph, me Troll Rex, you call Troll the King or Majesty. This school, mine now.Also me came here to study. Miss Temnota told me."
-
(Seeing as apathy has made me miss my cue to take control of the Otokojuku school, I feel it is now within my rights as virtually the only RPer who knows what the heck goes on in the school to jump right back in and take control of certain main characters)
While some of the more timid students freaked out at the sudden entrance, Momotaro, the head of the first year, remains nonchalant in his seat, seeming more interested in sleeping with his favorite manga plastered over his face than pay attention to the ruckus going on the other side of the pages. Onihige, the teacher in charge of teaching the students general education, among lessons of being a better warrior, doesn't even give the newcomer any attention whatsoever.
"Find a seat and sit down. We're about to move on to history lessons," he practically demanded.
(Download (http://hokutoarmy.wordpress.com/downloads/#SOJ) the episodes or go to Mangafox if you want to have a better grasp on how the school and the students behave)
-
Rex looked at the teacher, a sweatdrop appeared on his face.
"Yes..."
Mumbled the large troll and found a seat right next to the waddle dee.
(Research time!)
-
"You're right I suppose...I am also a bit curious as to how THIS RPM differs from our own." Afroman told A.Silan.
Meanwhile, as Waddle Dee saw the new student, a sweat drop appeared as he sat down next to him. Dee looked up at the massive troll and waved nervously. * -u-'*
(AH, I was wondering what the school was called so I could of researched it. Thanks. owob)
-
Flame finished his coffee, oogled over some of the Nekomimi waitresses, paid his bill and walked outside, wandering around.
-
Troll Rex then looked down at the Waddle dee, giving him a grim look.
When the leasson was picking up again, Rex looked at the sleeping Momotaro.
"Human, no respect towards education. Me no like it."
Rex then rather rudely removed the mangas from the sleeping Momotaro - by punghing his head.
-
Momotaro didn't react as sporadically as the other students that saw him; he merely eyed the newcomer while still keeping his hands behind his head.
Before Rex could think of anything more to do with him, a chalk eraser flies into his face, releasing clouds of smoke that was meant to choke and blind him.
"There will be no fighting in my classroom!" Onihige procrastinates, "One more outburst out of you and I will have you holding a tub of oil over your head with a single leaf saving you from bodily doom!"
-
"..." * '>.>* Dee wished at least someone wouldn't give him a grim look and a smile when greeted at this school. Dee was busy taking notes on the history lesson and when he turned his head, he began to panic as Rex was bothering Momotaro.
"!" Dee tried to do something but was easily blinded and choked by the chalk cloud around Rex, and rolled on the floor covering his eyes. "..." * ;O;* 'Boy does this chalk hurt' Dee though as he flailed a bit on the floor.
-
The stranger finished his Dr. Pepper, Paid his bill with an abnormally large tip, mainly because the waitress was kind and didn't question his odd clothing seeing as its quite warm outside, and walked outside, unwavering despite walking straight into the road and scaring the [parasitic bomb] out of at least two drivers. He climbed his way to the top of a nearby building and looked out at the horizion, the burned mansion in the background.
What to do now? I've made myself dead, I can't keep going around hiding my face or people will be suspicious... At least the new name will throw people off... "Anarchy", I should just use that from now on. And, since I was a loner, most nobody will recognize my voice...
The stranger climbs down, and presumes walking around the area, keeping watch for anybody who might've known him so as to not give away his identity.
[Yes, I will keep saying "The Stranger", until more characters (RP wise) are aware of my existance, then I'll switch over to "Anarchy".]
-
(I am giddy with joy to see this wonderful RP thread revived...now then, let's get this...seemingly started.)
The old man fixed his rugged bow tie while his crew prepared the stage for his announcements of this event. Men, women, children, reploids and other beings gathered around the city's massive plaza. The Sparkvanian competitors readied their vehicles for the race. Checking their engines, and tuning their rides, and checking their horses' shoe size. Among the competitors, the empress of Sparkvania made her metallic tent, where she watched from her throne, enjoying delicious and sugary sweets.
"All is going well, Mr. Hatter." One of the crew members told his rusty looking boss.
"Splendid! Splendid! And just in time too, 'cause I'm gonna make the final announcement before the show really starts! KYO HO HO HO!!" The top hat wearing man bemused.
*cough, cough*
WIEEEELLLCOOOMME EVERYONE!!!
Unless you have forgotten, today, YOU! The people of RPM are to race the POWERFUL, FEARFUL, UNHYGE-VERY CLEANLY AND SOPHISTICATED,
SPAAAHHHRKVAAANIAAANSSS!!!
And what is the grand prize for this race, you ask? Again, if you've been living under a rock this past few minutes, the GRAND PRIZE of this race is our very own home,
R P M!!!
I, your glamorous host, Mr. P.H.D. Hatter, will explain the rules of this in the following hour.
So in the mean time, those who haven't yet signed their names for the event, please go to the signing booths now.
And remember, THE FATE OF OUR HOME DEPENDS ON IT!!!
The rugged old man, stepped down from the stage and proceeded to descend the small stairs leading to his trailer/ But before he could rest his lungs and throat for the start of the show, he came back up to the stage, and said:
"..Before I forget, I have to warn you all. This race will be very risky and dangerous. I hope that those who still wish to compete a fully aware of this. In fact, there is a change some of you might not make it back to your homes...at least not unless you're in a coffin..." Mr.Hatter said in a grim tone.
"With that said, I HOPE YOU ALL HAVE A FUN TIME!!! KYO HO HO HO HO HO!" He said cheerfully.
With that said, the crew members finished setting up the booths and the rest of the stage. Though a bit weary of the challenge, those who were brave enough came up to the center plaza and began signing their names on the list. People both young and old signed their names and went back to their homes to get their riding vehicles to compete in the race. And though most of them were frightened, they knew what was at stake for them.
So they signed, signed in hopes that the army of Sparkvania could be halted long enough so that the missing, beautifully sexylicious, Queen Vixy or the duke of awesome, King Proto Blues I would come and save them, or at the very least, some of the local heroes of RPM would come to their daring rescue in the nick of time.
----------------------------------------------------------------------------------------------------------------------------------------
And with that, this racing arc may continue.
-
[Yay, Anarchy.]
Nova removed his human disguise, his metallic cuffs giving a faint white glow.
He gently levitated as to not disturb the grass. People didn't seem to give him much mind, obviously seen much more insane things than a star in the shape of a man.
As the sun fell his flames glowed smaller as he climbed a familiar tower, slightly abandoned except for those looking for a space to stay, or looking for a place to escape from someone. He became a small flame as he rested on the rooftop, odd for those who would be able to notice it.
-
The Stranger, being the observative type he was, came across a large white monolith... wondering what was inside he ventured in. unaware of the events currently taking place. [/dsi, hence the lack of any dialouge.]
EDIT: The stranger descended down the spiraling path of the Monolith, wondering why the hell anybody in their right mind would make a passageway like this in the first place.
It just goes on forever...
Eventually, he reached a door, and preceded to go inside. He was greeted by a console, for whatever reason, he was reminded of his childhood when entering this room.
-
Flame was wandering away from the Neko cafe when he saw the large crowd. He wandered into it, to see what the commotion was, wondering if perhaps Subtank was painting naked women with live models in public again, and arrived just in time for the announcement.
He knew the way that for some reason things were, and he knew that better a race than a full blown war. But in the end, the race may not be too different. people would likely still die. He also knew that he had to join, as part of his duty to protect RPM. So he walked up and signed his name on the list, and went on his way to Dr. Wily ll's lab where he could be teleported to FAUST to prepare his own vehicle. He had just the one in mind.
-
A flying pirate ship anchored itself near the starting point. Blackhookthe captain of the ship jumped down from it. His crew brought down the vehicle he will be racing with - a small sailing ship.
"The deserts already belong to me, but when the whole land is mine, I can help everyone (And maybe find outabout my past)"
Blackhook rememberred his meeting with Flame.
---------------
Some guards enterred Silan's tent.
"Sir, your vehicle is ready"
They reported to Adante, the man wearring a short sleeved red suit.
"Good good, I will make sure Sparkvenia wins mimiiii ♪"
-
Shortly after coming into contact with the console, the stranger noticed another door open. Seeing as there were possibly things in there that looked hostile he decided to continue down the spiraling hallway.
Why am I reminded of my childhood? Oh well.
He eventually reached the end of it, he opened the door, but instead of another hallway with more doors, there was a hallway with a giant wall of water cutting off the other side, Thinking it would take him to that terrible level in Super Mario 64, the stranger ran through the water....
And ended up on the other side of the hallway. Suddenly he could sense something wrong. He exited the hallway to find, you guessed it, ANOTHER SPIRAL.
The stranger climbed up the spiral, but was shortly cut off by two small huts.
What is this? did I travel to a spiraling area with Smurfs?
The huts then moved apart to reveal that they were some sort of robot.
Oh [parasitic bomb]... did I just travel into a different universe? Is this another gate?
The stranger darted up the spiral as quick as he could to get out, when he finally reached the exit he was shocked.
This is not RPM... Where the hell am I? Whats with all these cats?
-
Hajime managed to secure a vending spot to sell some much needed refreshments to the spectators and the competitors joining the race. Among them is his Blazkrieg superior, Ryuta, who showed up with nothing but his red, ZX-modeled ride chaser, and the Cyber Elf version of Tango, who rode on a cloud many spectators claim he stole from a sleeping Lakitu.
-
Confused about his location still, the Stranger ventured out, only to not be able to walk through the darker green grass, like some sort of invisible wall was in his way. He turned around and noticed the large grey wall, the little door on the wall read "N".
That must be the way out...
Trying to open the door was futile, because it seemed like it was painted onto the wall, touching it however, made him freeze while the whole world around him vanished. In a few seconds the world came back, but he was in an industrial area, a dead looking city full of grey buildings.
Hey look! Dogs!
The stranger ran towards the dog, the dog stood up, barked, and proceeded to run at the stranger, knocking him over for some odd reason.
[tornado fang]! That hurt!
He noticed a man walking around wearing a construction helmet, this man was noticably blocky in appearance.
Hey, could you tell me where I am?
This is the old city, people used to live here. If you want to go to the Main gate go South, The power plant is North.
Old city of what?
This is the old city, people used to live here...
Yeah, Yeah, I know that. WHERE?
This is the old city, peoply used to...
[parasitic bomb]. HE BROKE.
The stranger decided to hit the man across the face, but tried to and ended up seeing his fist pass through the man's head.
-
As the time passed, more and more competitors began to show up. Several of the newly signed in competitors were average RPM citizens, however, there were a few that seemed to stand out from the rest.
One such competitor is a young man name Garm Dasce, who came to the plaza on a motorcycle. This lightning haired individual seemed to be a new face in town. He wore a dark green jacket and had a small box strapped on to his belt. He bore a confident, yet slightly arrogant smirk as he looked around at the events competition.
Another notable individual was a homeless man of a large stature. He was oiling up his stolen shopping kart and checking his inventory. Some of the citizen suspect that the man is part of the sparkanian racers alignment.
Another notable individual who is competing in the race would be the very woman who was pasting the posters of the event through out RPM. She merely stood there, gazing at the sky, waiting for the competition to start.
-
The stranger quickly exited the "Old City" and appeared in a nice little downtown square.
What is that music?
Suddenly he saw a bus passing by.
Hey, I'd like to ride the bus! Hello!
He tried opening the door but for whatever reason it wouldn't open. The bus kept trying to move.
Oh come on! Bet you will stop if I jump in front of the bus!
The stranger ran in front of the bus and stood there so the damn thing would stop.
HA HA! NOW YOU HAVE TO GIVE ME A- OUCH!
The bus did not stop and ran into the stranger anyway.
This place does not make any sense, does it? they're socially retarded, they don't notice if people are infront of their vehicles, dogs keep attacking me, cats are stray outside, the dark grass is a hidden wall, AND PEOPLE KEEP THROWING MONEY AWAY LIKE IT WAS OLD GUM!
He decided to keep looking around, why not have a little fun while in this city?
-
Inside Silan's tent.
"Sieg, it appears someone is ouside selling illegal merchandise. You know what to do?"
The misstress of Sparkvenia asked her loyal servent who then teleported outside.
"Where is MR. Hatter? I'd like to speak with him."
Outside
Ritter Sieg teleported near the wending place where Hajime was selling his stuff.
"Excuse me my good sir."
The knight approached Hajime
-
Hajime looks towards the knight before pulling out a permit purchased at the stadium office, "Everything here is completely legal and safe to buy. Go ahead and check if you don't believe me."
-
"KYO HO HO HO!! Did you call for me, Princess?" Mr. Hatter asked the empress. As he was popped out from the tent's folds.
"I couldn't help overhearing your loudly anno-beautiful voice on the way to my trailer. So, just hooow can I be of service, dear?"
-
The stranger went around the town, along the way he found an old car.
Looks like this hasn't been used for a Decade.
Looking inside the car... Is there anything inside?
SWEET!
Suddenly, a textbox:
You got: A ton of powerful weapons and equipment!
Alrighty, why are these blue? No matter, I can use these...
The stranger took the weapons and equipment and left to the "Main gate". Using the weapons to get through the spiral he was able to re-enter the portal and get back to RPM.
Alrighty, now that I got some stuff.. maybe I can participate in that race.
The stranger equipped the Kevlar Armor Omega and the Jet Skates, equipping a selection of weapons into the Hammerspace known as his jacket. (Those weapons are Machine Buster, Drill Arm, Splash Mines, and Powered Buster.) Also making sure to take the Energy Canteen (99/99) in case of perilous damage.
The stranger, now fully prepared to race, walked to the sign-up and signed in. Using once again, the code name "Anarchy".
[You didn't think I was just going to sit Idly in MegaMan Legends Land did you?]
-
(Speaking of the race, what kind is it?)
-
"KYO HO HO HO!! Did you call for me, Princess?" Mr. Hatter asked the empress. As he was popped out from the tent's folds.
"I couldn't help overhearing your loudly anno-beautiful voice on the way to my trailer. So, just hooow can I be of service, dear?"
"Well for starters you should stop talking so informal with the misstress!"
Replied an angry Stolz, hesitating to fire one or two shots at the man's hat.
"Well Mr. Hatter, I hope that you won't mind when I tell you that I changed the rules a bit. I've made Temnota the main referee of this race, with the white knights as her helpers. If there will be any rule violation that they will take care of it. Also I arranged that every partisipant will become a badge with their number. The badges will allow the referees to follow and track down each participant. Remember I do wish for Sparkvenia to win, but it will be a fair race, I will make sure of it."
----------------------
Sieg read trough the papers Hajime gave to him.
"Well, everything seems alright, but I hope that I don't have to remind you that you have to pay 40% of your complete income to the leader of Sparkvenia."
Said the knight.
-
Hajime waves off the reminder, "Don't worry, I don't cheat official governments. I'll have the payment ready by the end of the race."
-
"Well for starters you should stop talking so informal with the mistress!"
Replied an angry Stolz, hesitating to fire one or two shots at the man's hat.
"Well Mr. Hatter, I hope that you won't mind when I tell you that I changed the rules a bit. I've made Temnota the main referee of this race, with the white knights as her helpers. If there will be any rule violation that they will take care of it. Also I arranged that every partisipant will become a badge with their number. The badges will allow the referees to follow and track down each participant. Remember I do wish for Sparkvenia to win, but it will be a fair race, I will make sure of it"
"But of course, Princess. I'm sure your cousin and those tin toy-fine, fine and strong knights of yours will make fine referees. The badges are a marvelous, I say simply marvelous idea. Like I always, you can never have enough sucke-security! Plus it just wouldn't be a race if there was no sportsmanship from the competitors." The eerily cheery man told her.
"However, I will still need to make the announcement myself, if you don't mind." Hatter said in a more serious tone.
[@Flame:Here's a hint, bring weapons...and a pajamas]
-----------------------------------------------------------------------------------------------------------
In the plaza's eastern entrance arrived a peculiar bunch.
"Huh, wonder what's all the hubub about" The green hooded grinner, ST asked, mostly to himself.
"Looks like some kind of race is about to start. Though some of the people looked a bit worried for some reason." Replied the metallic felisapien, Nekolyan.
"...Guh, where's the food?" asked The strange chimera cyborg, Brocky Bulldawg.
ST was seemed happy over hearing the word race. His hands shook in excitement.
"Oh boy, another competition! Come on, let's go join in the fun!" He joyfully told his companions, as he zigzagged his way to the signing boot, pretending to be an airplane.
The other two looked at each other and followed in ST's lead, though not as playful as the green man was.
[Just gonna stretch that hour a bit longer so members who are still interested in this arc but haven't joined yet can have a chance in participating in the upcoming fray.]
-
(Well, I meant sort of like if it was just a race race, twisted metal demo derby, or what, but I get the idea.)
-
The stranger, now prepped for this race, stood at the entrance. Waiting for it to open, because of his lack of vehicle, people got rather confused and laughed at him.
Does he think he'll win by just running? Bwahaha!
HEY KID! YOU MIGHT WANT TO GET SOME WHEELS, LEST YOU WANNA GET LAST PLACE AND DIE! HAHAHA!
The Stranger looked at them with a blank face, emotion wasn't readable due to his Sunglasses.
-
"Oh and don't tell anyone about the true purpose of the badges, it will make things more..interesting."
Said Silan. At the same time Sieg teleported back. The knight looked at MR. Hatter and showed him the cold shoulder.
-
Flame walked down the outer halls of FAUST, sipping an iced coffee as his gaze diverted out of the large windows to space that ran down the length of the hall. He had just finished putting a touch or two on his vehicle, and decided that it was good enough for the time being. He would possibly test it later to see how it held up. But for now, a break was in order. Maybe a nap too. it was a long time since he last slept, and although he technically did not need it, he found it rather relaxing to get some shut eye.
So he changed direction and headed off towards his office at the top of the station.
-
Ryuta observes the latest newcomer to the race, not making much effort to say anything that won't get mixed in with the verbal reaction of the ignorant crowd. He can tell by the spiritual expression flowing from the stranger's body that there was more to his decision to go toe-to-toe on the designated path than thinking himself too cool and sexy to properly read the flyers.
With class over, the students head out to the front of the school in preparation for today's Physical Education to better Manliness. All of the First-Year students line up in a perfect square in front of the wooden podium, awaiting Rankiryu's presence.
-
Blackhook also observed the stranger. He appreciated the man's bold decision, after all people were also giving weird looks towards his vehicle - a sailboat. The man seemed familiar for some reason, just like many others in the crowd. COuld it be that what Flame said was true and that he has forgotten his past? He might find here someone who truly knows him...
Troll Rex was standing out of the line. He looked over the waddle dee.
"You know what's going on?"
-
After signing his name, ST joined the other racers, morphing his back cape tail into a uni-motorcycle. When he parked his vehicle near a floating pirate ship, he felt a familiar presence in the vessel.
ST looked up and saw the ships supposed captain.
"...Hey, have we met before!?" ST shouted at the hooked pirate.
Nekolyan was looking at all the different competitors, he would have liked to join the race but he had no vehicle to call his own. And since he did not live in RPM, he wasn't sure where there was a nearby sports car depot, of course he still wouldn't be able to afford it. The he saw the cooking competition's host, which he remembered that he worked at Junkyard which he uses as an inventory of sorts to sell used parts.
The cyborg went straight to him and asked: "Hey uh, Hajime was it? You wouldn't happen to have any spare car parts there"
Meanwhile, Brocky was getting better acquainted with one of the competitors, specifically, the runner known as Anarchy. Though he mostly just stared at him rather than actually talking to him.
In the western gates of the plaza, arrived three more potential competitors.
"Hmmm, looks like this RPM isn't as different as our old one." Said the gentleman like figure who wore a bowl hat, clock like monocle and had an umbrella in his hand.
The second figure, who was mostly shrouded in a thick cloak and was smaller than the gentleman, held his other arm tightly.
"Uh, Clockston, there's a lot people here...I wonder if we can find 'him' here with all the crowd in the way." She said to her companion, grabbing his arm tighter.
"..." The taller figure with the opera mask stood silently gazing at his surroundings.
-
Blackhook, who was currently inspecting his boat turned to the masked man.
"Huh? Were you calling me mister?"
-
ST nodded at the captain.
"Yeah! I asked if we've met before! You look strangely familiar...did we go on a date!?"
-
Troll Rex was standing out of the line. He looked over the waddle dee.
"You know what's going on?"
Waddle dee nodded and sweat dropped. If there was one class he never did enjoy...it was PE.
-
Hajime looked towards Nekolyan, seeming rather confused that he would mistake him for his high-ranking friend.
"You're confusing me with my friend, who's competing in this race," he said, "And I'm afraid there's rules against selling parts on racing grounds, so you're going to have to some other way of beefing up your ride."
After a few minutes, Rankiryu makes his way to the podium and turns to the front of the First-Years, plopping the foot of his padded javelin at his side.
"Attention, First-Year," he began, "Today we will be doing the Forward March."
There were several complaints among the students, obviously they were put through this exercise before and were baffled that they had to do it again. Rankiryu "taps" his javelin on the podium before speaking again.
"Now, for those of you who are new to this, all you have to do is walk in a straight line, that's it."
He heads towards a circular compass carved into ground and places his javelin on top of it, making sure to keep it balanced. Once released, the javelin tips over and lands in one of the eight triangles making up the circle. He examines its direction before turning and pointing towards that direction.
"Alright! We will be heading North East from here!"
He then stabs the school flag in front of Waddle Dee, sending enough tremors to knock him off his feet, "You! Since you haven't pulled any of your weights in beefiness, I will assign you the honor of carrying our famed Otokojuku flag! Don't you dare drop it during our Forward March or I will have you doing doing Bunny Hops with your hands until dinner!"
-
Troll Rex raised his hand.
"Sorry teacher, if we encounter building we allowed to smash it?"
----------
"A...a date?"
Blackhook turned red. He didn't remember his past but he never thought that he would be that kind of a man. He was sure that he was attracted to women..maybe this masked persone was infact a woman? Blackhook starred at ST for a while.
"What's your name?"
-
"Oh, sorry. I was sure you were called Hajime...and actually I was hoping you had some spare parts so I could make a vehicle. Anything will do really. Even if it's just four used wheels, an old engine and a shell." Nekolyan told the merchant.
"My name!? They call me ST! By the way, are you a captain!?" The hooded masked man said to the confused captain.
Brocky continued to stare intently at the Anarchy.
------------------------------------------------------------------------------------------------------------------
"Ladies and gentleman! The competion shall
begin in the next 30 minutes!
Those who have wish to participate
but have not signed their names yet,
please do so now!
-
Hajime sighs a bit in irritation that Nekolyan misinterpreted what he said earlier, "I already told you I can't sell spare parts before a race. You'll either have to make do with what you have or find someone else willing to break the rules.
Rankiryu leers towards Rex with a cynical smirk escaping his large lips, "All you have to do is walk in a straight line; let nothing and no one stand in your way! That is one of the keys to being a true warrior among men!"
-
"Anarchy" stood waiting at the gate. Motionless as ever. Noticing somebody staring at him, he adjusted his cloak so his face was not visible.
Sitting there waiting for 30 minutes was quite a drag.
-----------------------------------------------------
Somewhere else, a different stranger appears, also hooded, but for an odd reason his hood has a large spherical object underneath. This stranger slowly walks through the town, his bearded face not moving a muscle, always looking like a serious frown.
-
BH adjusted his wide brimmed pirate hat.
"Why ofcourse I am a captain!"
Suddenly BH crew started annoucing their captain.
"HE is the hero of the RPM desert!"
"His hook can tear trough everything!"
"He is faster than the wind!"
"Wind acts at his command!"
"HE IS CAPTAIN BLACKHOOK!"
The crew started cheering while BH did some poses, the jacket on his shoulders was flapping dramatically in the wind.
"ST was your name? As in Strange Man?"
The hooked captain wasn't sure why he rememberrred that name...
Troll Rex started laughing creepily.
"This be fun!"
Silan heard the annoucement
"Get ready"
The four knights teleported out of the tent while Temnota disappeared in the shadows.
-
"Anarchy" Sitting Paitently at the entrance gate, finally prepped himself, making a few last minute tweaks to his Jet Skates (Improvement of Overall Speed and warmup time, along with enhanced boosters.) He jumped up, prepared to race, making sure his cloak was covering his Right arm and his face.
-
After a few minutes, Rankiryu makes his way to the podium and turns to the front of the First-Years, plopping the foot of his padded javelin at his side.
"Attention, First-Year," he began, "Today we will be doing the Forward March."
There were several complaints among the students, obviously they were put through this exercise before and were baffled that they had to do it again. Rankiryu "taps" his javelin on the podium before speaking again.
"Now, for those of you who are new to this, all you have to do is walk in a straight line, that's it."
He heads towards a circular compass carved into ground and places his javelin on top of it, making sure to keep it balanced. Once released, the javelin tips over and lands in one of the eight triangles making up the circle. He examines its direction before turning and pointing towards that direction.
"Alright! We will be heading North East from here!"
He then stabs the school flag in front of Waddle Dee, sending enough tremors to knock him off his feet, "You! Since you haven't pulled any of your weights in beefiness, I will assign you the honor of carrying our famed Otokojuku flag! Don't you dare drop it during our Forward March or I will have you doing doing Bunny Hops with your hands until dinner!"
The waddle dee nervously nodded his head and grabs the flags staff,"..." * -u-'* he tugged at it but couldnt get it out seeing as it was kinda jammed in pretty deep.
"Ladies and gentleman! The competion shall
begin in the next 30 minutes!
Those who have wish to participate
but have not signed their names yet,
please do so now!
"..." Agent J (Havent seen her inna while :P) , quickly signed and looked around for Afro-Man and A.Silan. Spotting them, she chose a spot several cars behind them and took out a pole, holding it horizontaly, it formed into a high tech motorcycle around her like something from the movie Tron. As the race was waiting to start she sent a quickl relay message to Master D in A.RPM. 'Afro-Man found. Continuing surveillance.' was what the message read.
-
Rankiryu heads over to a large, square, titanium plate and flops down on it, crossing his arms and legs as four students walked over and hauled the entire structure onto their shoulders. He leers at Waddle Dee, seeing him struggle to pull the flag out.
"Come on, bean head; time's a-wastin'," he practically demanded, "The class can't move without their resident flag holder leading the way; and if the class doesn't start moving in the next hour, then they will be doing more than hand-standing Bunny Hops 'til dinner. And who will they blame for making them too tired to even lift their chopsticks?"
-
In a fit of panic and adrenaline, (mostly not wanting to get the entire class pissed at him) He managed to barely pull out the flag. "..." He held it up a bit in disbelief. How ever he quickly ties a bandanna to his head with the word 'Determination' written on it and made his way to the front to lead.
-
Rankiryu's sneer widens at Waddle Dee makes his way to the front of the class before pointing in the direction determined earlier, "Forward March!"
Without any acknowledgement, the class begins marching off in the direction he pointed in, carrying him within the center of the line.
-
The waddle dee waddled hurrily in the direction assigned earlier and lead, hoping nothing to extreme or weird would get in their way.
-
As the racers prepared their rides for the final moments before the race, Flame finished the touches on his own vehicle up in his space station and had it transported down to RPM. After about 20 minutes, a darkly colored squarish cargo spacecraft landed slowly in the area where all the racers had set up their pits. The cargo ramp on the back of the craft opened with a pneumatic hiss and touched ground.
2 young men in jumpsuits came out the back and helped bring a car out, leading it down from the sides. It was covered with a tightly wrapped blue tarp. From behind, holding the back of the car, emerged Flame, with a sports jacket on over a black race jumpsuit.
Once the car had been taken down the ramp, they removed the tarp. Under which there were what appeared to be black and yellow armor plates placed on certain angles, all around a harness fitted around the car. They removed these too, and then the car was fully visible.
http://www.diseno-art.com/encyclopedia/concept_cars/de_tomaso_ghepardo.html
After a few moments of checking the car thoroughly, Flame took off his jacket and opened the door, throwing the jacket inside, revealing his jumpsuit matched the car's color scheme. It also looked padded and possibly armored. He got inside and revved the engine up. It reverberated powerfully and the lights lit up. He turned it back off, giving a thumbs up to his two man pit crew and saw back in the seat, drinking a drink he was given by one of them, waitng for the start of the race to be announced.
-
15 minutes have passed and more and more competitors were signing their names and bringing their own unique vehicles. Soon the grand event shall begin, but for now, let us see more of the strange participants who are competing in the race...
One competitor was a man who was riding on what appeared to be a hovering coffin. Of course the only thing seen from this competitor was a glimpse of his arm as he was signing his name on the list. The coffin had the emblem of an owl on the top and was engraved in jade green jewels.
Shortly after their arrival, the tall cloaked man with the opera mask signed his name on the list.
"Eh!? General Crimson, what exactly are you planning to do? Tic-toc." Clockston asked concerned for his superior for some reason.
"I wish to join the race, of course...are you and Sally going to join me?" The man replied, in a calm manner.
"You cannot ride with me though...it would be more interesting if we each drove our own carriges" He left them and went back towards where they had entered the plaza.
"H, Hold on General!...How are we supposed to compete in the race without having any vehicles of our own!?" Clockston shouted.
"...You know, I could make myself into a car or horse..." Nightmare Sally suggested.
"Nonsense child, we haven't the slightest idea how long this competition will be, and I don't want you to tire yourself out carrying me all over the place...there should be some sort of transportation device around here somewhere." The two peculiar individuals went towards the city's shopping district in hopes of finding a vehicle to use for the race.
----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
Meanwhile, our dog headed vegetable finally decides to speak to the man named Anarchy.
"...You are planning to run the whole race?..." Brocky asked with a bit of doubt.
During all this, Nekolyan was a bit flustered since he could not buy any parts to use to make a vehicle.
"Nyar...you wouldn't happen to know any place nearby that I could scrounge up some parts?" He kept pestering the merchant.
Back with ST and the pirate, Blackhook.
"Yeah, Strange Man was my name! How'd you know!?" ST shouted happily.
"So, you said your name was Blackhook!?" He said in shock.
"...Why does that sound so familiar?"
"...So you're not Captain Crunch!?" ST asked the captain.
-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------
Hey there folks! Just wanted to let you know
there are only 10 minutes left before
we officially start the Race of Destiny!!
So be sure those cars, motorcycles, horses
and all those doodads are in top shape!
This is your host, Mr.Hatter, signing off!
KYO HO HO HO HO!!
-
The Sparkvenian all star racers were slowly getting ready for the start. The top bvenia were the following:
Andante van Bethin - The leader's second confidant, a showt man with wild hair wearring a short sleeved red suit with no tie. He was driving a humvee with large speakers attached to the front, side and back of the car.
The Spark 6 - A team of sentai like superheroes. A great team of six people all named after animals (each of them is wearring a helmet representing their animal, even their vehicles look like carified animals). Gecko the leader, Hawk the smart one, Ox the quiet muscular lady, Sloth the hyperactive youngling, Dolphin the fat acrobat and Snail the snail..no really a mutated snail.
Rumor has it that their cars can combine...
Turbo X540 - A battle robot that can turn into a tank...tanks aren't famous for their speed so, why would he enter?
Sachertorte - A famous bounty hounter who uses technologies Boba Fett would be jelous off. He will be riding his robotic horse Pfeferkuchen.
And many more unnamed extra participants.
Will the sparkvenians win this race and claim RPM as their own?
It didn't take long and the students came across the first building. Rex looked at the leading waddle dee.
"Hey, small one, since me new here I will let you go trough the house first. Ain't me nice?"
"I'm not sure why I do know your name or why would you think I'm a certain Mr. Crunch..."
Replied BH
"How come I knew your name?..Weren't you working on my ship?"
-
Hajime sighs a bit in further exasperation of Nekolyan's persistent pestering, "I'm sorry, I can't; that's also violating the vending rules. I'm only allowed to sell refreshments to spectators and passing racers."
Genji Togashi, one of the more seasoned students of the First-Year, lets out an unamused snort as he moves to the front of the class, holding a large mallet, "Please! The meatball can barely hold a flag the weight of a bo staff! You better let me handle this obstacle."
Without waiting for an objection, he raises the mallet with no effort and slams it against the wall, revealing the interior of the Neko Cafe. The catgirls running the place screamed in shock and surprise as they saw a familiar trauma surrounding the very hole that appeared before them.
-
It didn't take long and the students came across the first building. Rex looked at the leading waddle dee.
"Hey, small one, since me new here I will let you go trough the house first. Ain't me nice?"
Waddle Dee sweat dropped and looked at Rex as if he was actually serious. '3_3'
Genji Togashi, one of the more seasoned students of the First-Year, lets out an unamused snort as he moves to the front of the class, holding a large mallet, "Please! The meatball can barely hold a flag the weight of a bo staff! You better let me handle this obstacle."
Without waiting for an objection, he raises the mallet with no effort and slams it against the wall, revealing the interior of the Neko Cafe. The catgirls running the place screamed in shock and surprise as they saw a familiar trauma surrounding the very hole that appeared before them.
He borrowed his brows at his comment, he could at least carry MORE then this. But before he could point out that they were at the Neko Cafe, CRACK!, a hole formed and choas insued inside. "..." He faced palmed and followed.
-
The Mysterious Mystery Man continued through the streets and stumbled upon the Neko Cafe (Convienently, as it seems everybody goes there at one point or another.) He sat down at the bar while a panicked catgirl took his order.
You want something? Please hurry! Nya~
Water.
A cold glass of water was slid down and caught by the man's rather large hand. Instead of him drinking it, he instead pulled out what looked like a stuffed toy dog, with Zippers thrown about. He forced the water down the odd specimen's gullet, with it screaming in pain what sounded like "Chuck".
Sir, what is that? Nya~ It looks like a Dog, Nya~
Its just Chuck.
What on earth is a Chuck? Nya~
The man looked up at the innocent Catgirl, his reddish pupils staring straight into the catgirl's frightened eyes.
Do you know where the nearest location of intrest is?
Uhh... I actually don't know, Nya~
Thanks Anyway.
The man paid the poor catgirl and walked out. Chuck followed shortly after.
[Just throwing a little PSG Flair into this joint, no biggie.]
-
You know what, Im actually gonna not participate after all.
*retconned*
-
What? Why not? This was just starting to get its feet back!
Of course, since your post declaring your retconning from the RP came right after mine I feel like I had something to do with it. :\
-
Not at all. I just dont feel like Rping a race anymore.
Ill just hang around and follow the race instead. maybe at the neko cafe. 8D
-
You make me a sad pirate >.>
-
The First-Years marched through the cafe, giving no attention to the Catgirls as they flee in random directions to avoid being trampled on. Ryuji Toramaru, the third of the seasoned students, grabbed random food off the ordering window as they passed through the counter towards the other end of the cafe.
-
Not at all. I just dont feel like Rping a race anymore.
Ill just hang around and follow the race instead. maybe at the neko cafe. 8D
OH, I thought you were removing yourself from the RP.
-
Dee kept leading the march, " :|" He saw but ignored Ryuji Toramaru's actions seeing that if he messed up on the march, he'd be in for alot of trouble with the other students.
-
Troll Rex wandered forward with glee, enjoying the chaos. He looked down at the Dee
"Little one, you doing good, but I bet you can do better!"
-
The mysterious cloaked man found his way to a TV studio, without anybody caring he walked on into a set of a Newscast, sitting down next to the undeniably attractive female news anchor.
Move aside, please.
The news anchor moved aside for the man to move to the center of the camera. Without hesitation he shedded his cloak.
Underneath the cloak was a man dressed in a white robe, up where his head would be was a black mask with a large afro shaped spot on the top of it.
The only holes visible were for his eyes and mouth, his eyes were yellowish with red irises. He stood up and exclaimed:
GOOD EVENING CITIZENS OF RPM, MY NAME.... IS MASTER G! I WILL BE HERE OBSERVING YOU AND HOSTING INTRESTING EVENTS. YOU WILL SEE ME AGAIN!
Chuck.
"Master G" Walked off the set, Chuck following him.
-----------------------------------------------------------------------------------------------------------------------------------------
Meanwhile, "Anarchy" was getting irritated at the wait, it had been "10 minutes till the start" for at least 3 days, it seemed.
When is this going to get over with? God-damnit this is annoying.
-
The man with the opera mask came back with a small, on seat crimson sports car, stylized with some victorian era decor.
Though not noticed by much, the man seemed a bit fatigued. From what could be seen from his face, he seemed to had grown a bit pale.
Brocky was a bit flustered by the fact that Anarchy was ignoring him, but not one to dwell too long on such things, he decided to quickly go to the signing ballot to put his name on the list. After doing so, he quickly dashed off to get a vehicle.
------------------------------------------------------------------------------------------------------------------------------------------------------------------------
Passing by the broccoli dog, the duo, Clockston and Nightmare Sally came on an old motor bike with a side seat.
"Hey Clockston? Do you think they'll let us ride together?" She asked with a bit of worry in her voice
"Hmmm, Perhaps. But not to worry Sally, I made a few modifications to your "seat" just in case something like that happens. Tic-Toc" The steel gentleman said as he gently patted her head to calm her down.
"Okay...but I don't know how to drive." She worried again.
"As I said before, not to worry, I made sure the controls are so simple, even a cave man could do it." Clockston said proudly, before swiftly being pelted in the back of head by a bottle of red wine.
"Gozhx! WHAT ILL-MANNERED BUFFOON THREW A PERFECTLY GOOD BEVERAGE AT THE BACK SIDE OF MY METALLIC CRANIUM!?" Clockston bellowed.
And what he saw behind him was a well dressed and groomed hairy man with long flowing hair and predominate forehead, wearing designer shades.
"You better watch what you say gramps, some people get a bit touchy when they hear things like that." He said, scowling a bit as he rested on his shiny go-kart.
---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
Nekolyan was panicking a bit since he couldn't find a vehicle to ride in.
"Gah! Come on Nekolyan, this is your chance to get some more screen time! Come on, you can probably make something out of some random trash on the streets. Hell, I was able to make roasted sausage out of vegetables...withouth even cooking it properly! I can probably make some cool hovercraft or something outta 2x4 and toilet paper tubes if I put my mind to it...course it could also be as terrible as that sausage was." The cyborge humanoid feline thought to himself.
Meanwhile, Brocky Came Back with his special vehicle...a cardboard box...with wheels drawn on its side...and a drawn on license that reads 'TUF-PUP'.
---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
Be prepared folks, cause the race shall start soon enough!
Only three minutes left before the competition starts!
[@Flame: Well that's a bit depressing. But that's your choice. Hope you'll enjoy watching the upcoming events from the sidelines, with a hot cup of coco, sitting by a fireplace, surrounded by females with feline characteristics in maid outfits and breast of various shapes and sizes...you poor, poor man.]
-
((Oh I'm suffering already.))
-
"Anarchy" Stretched a bit so that when he was racing he would not pull any muscles.
Suddenly he looked around.
Is someone there?
Not noticing anybody staring at him, he quickly removed his cloak and slipped a gatorneck around his neck, and used it to cover the rest of his face.
He quickly redonned his cloak and was ready to race, his face now almost completely obscured.
Posted on: February 17, 2011, 09:35:46 PM
I can't seriously be the only person willing to continue this RP. We haven't even gotten to the parts where it gets good!
-
The Otokojuku parade eventually plows through the other side of the Neko Cafe, leaving most of its feminine feline hybrid employees shaken and crying over the cost of the repairs and the counseling they had just gone through the last time they were involved with the male-only school.
Their next destination as they continue their Forward March exercise is the entrance to the race that was about to go underway. Whether or not this will affect both the race and the school is yet to be determined.
-
The four Silan knights were standing around, waiting for the start of the race.
"Man, it sure feels like we are waiting for days"
Said Sonne, the knight with the sun shaped mask and cape
"It is only because you are impatient...though I really wish we could get this over"
Replied Stolz, the only female of the four.
"Hey, what´t that dust cloud over there?"
Schimmer, the smallest and youngest of the group pointed at an incomming dust cload - the students of Otokojuku.
"They look like students...on steroids"
Said Sonne.
"Isn´t that Mr. Rex?"
Asked Sieg
Suddenly Temnota, the young whitehaired girl emerged from SIeg´s shadow.The girl got excited seeing familiar faces
"It´s the boys :D "
"You know these...old manga rejects?"
Asked Stolz
"WHy ofcourse, as the winner of the ironchef contest I also had the honor of becoming the chef of Otokojuku. Coll isn´t it?"
Stolz, Schimmer and Sieg looked at her with disbelief, only Sonne was impressed by that
-
Master G Walked through the streets with his companion chuck, suddenly out of nowhere, Chuck decided to run off in chase of a crowd of people.
CHUCK CHUCK CHUCK!
CHUCK! GET BACK HERE YOU DUMBASS! HOLY [parasitic bomb], NOW WHO AM I GOING TO USE AS A GPS?
Chuck continued until he got to the same location about 90% of everybody else doing this RP was located, the race grounds.
Chuck?
Noticing what he thought was food, Chuck's attention was caught by a nearby concession stand, he then decided to devour the concessions, shortly before he was stepped on by a random bystander.
-
[Sorry this RP hasn't even really started guys, some things came up that holds me from getting this show on the road. Hope you guys can wait a bit longer.]
-
Hajime just stares at the strange..."chuck" thing that was eating up one of the foods stacked in the coach of his dragon truck before slowly turning around and scribbling down the cost on a generic restaurant bill.
Ryuta tries to pay little attention to the Otokojuku students that were passing through the starting gate, not paying attention to anything but the direction they were ordered to walk in. Any participating drivers that weren't owned by the RPM users were either bowled over or sent fleeing to the nearest wall to avoid getting trampled by the seemingly abnormally strong stampede.
-
Chuck stares at the Bill, drooling. Before he completely ruins the bill, Master G grabs Chuck by the skull.
So here's where you went, devouring this food.
Master G quickly pays the bill and stands around at the Race site, looking more conspicuous than the mysterious "Anarchy". Speaking of whom...
"Anarchy" is busy looking around, standing still while the students of the school walk past him like he isn't there.
He notices Master G and blinks to reaffirm himself.
Impossible, if he is here then are they here as well? I don't see any sign of them so I must be in the Clear, cheating death wasn't wise.
-
Gaia, as the guy that he is, attempts to avoid any shenanigans this time around, but notices someone familiar under the heat signatures giving off from under the robe..
But he shrugs it off and decides to take a seat in the best part to where he can watch the race. And bid. To replace his broken drillstation that has been apparently been forgotten since the previous incidents recorded.. then again.. Outer Space has always brought nothing but trouble.. He can tell.
"Dough weigh me dough' weigh me dough weigh me... STOP!!"
The crowd looked at him in minor annoyance, thinking he was one of the people who place a bet on the racers, hoping the selected racer would win. He shrugged it off, and sat back down, reminding himself not to do that again.
-
"Anarchy" pulled a small red gem out of his hammerspace of a cloak, hooking the thing together to a webcam to scan the area. He turned it on and started panning back and forth, holding the webcam.
Search Object... Angels...
SCANNING....
SCANNING....
SCANNING....
RESULTS... ZERO MATCHES FOUND.
Phew. Good thing, or else I was going to have to RP more characters. I think thats beyond my ability at the moment.
WARNING! 4TH WALL BREACHED, PROCEED WITH CAUTION.
Oh shut up.
-
(Thank god, this Rp isn't ready for THAT)
Andante the musician then noticed 'Anarchy' among the crowd. He then approached the mysterious figure.
"Miii miii, hey you! How's yer pretty wife doing? ♫"
-----
Suddenly from Rankiryu shadow emerged Temnota. The students now had to struggle holding two people.
"Hey there MR. Pilot cap! Is it Tuesday again?"
-
(Humor, my good sir, humor. The point is that they do exist, they just aren't in the story for the time being. I mean I already threw Master G and chuck in so why not? Just not Now. :P)
Anarchy looked at the musician, sunglasses preventing his eyes from being seen.
Wife? Sorry I don't know what you are talking about, I've never been married.
[Oh right, didn't mention this on this topic but in the Secret Files but I retconned Kallen's existance after her death in the original Busy World, hence her and RMZX never got married (Making that whole sub arc non-canon.). RMZX decided to cheat his death and re-emerge as "Anarchy". Technically nobody should know that "Anarchy" is RMZX, but the disguise and false name don't fool everybody. Of course, the name also seems to arouse the intrest of other certain individuals.]
-
"No? Oh well, I guess that I just rememberred miiii something that franky did not happen...miii"
Andante starred suspiciously at 'Anarchy'. He summoned a flute and played a short tune on it.
"Well, I hope you won't cause any trouble miii, see ya at the race miii"
-
Gaia, mistaking "mii"s for "mmmew"s, thinking it was a cat and begins to chase it off. While doing so, he passes a man with a rather.. absurdly large 'fro.. He thinks to himself "Damn, how DOES he get through a door without his 'fro getting stuck?", he ignores it to find the damn cat.
-
"Anarchy" pondered about what the strange singing man had said.
I was.... Married?... This confuses me...
-
"Hey, heeeey! have you seen a cat nearby? I've been looking for one!" He runs up to the strange singing man, asking to where the cat went, ironically enough that he was the one producing the noise.
-
Rankiryu just about fell off his platform in shock as the four students holding him almost collapsed from the near impossible addition of weight.
"Ack! Wh-What the...!?!?" he wails, almost seeming to act like he didn't recognize the new arrival.
-
"Anarchy", still pondering about what the strange singing man said. Decided to walk around for a bit since the race had been put on hold.
What did that man mean? There's no way I was married... The last person I cared for died in my arms...oof!
"Anarchy" bumped into somebody... he slowly looked up while saying:
Sorry, I didn't mean to... *gasp*
That "Somebody" was "Master G".
Oho, so its you...
Chuck Chuck.
"Anarchy" backed up slowly, then preceded to start running away to avoid "Master G".
......
Little did he know that Chuck had sort-of latched onto his cloak.
Chuuck!
[parasitic bomb]! Get off me!
"Anarchy" managed to get chuck off of his cloak, but not before chuck got a small bit of fabric from it. (Which doesn't matter anyway as it looks tattered to begin with.) He found a place to relax for a small bit.
What does he want with me? I feel like I'm not getting told something.
-
"Gah! AFTER THAT CAT!" He finds a rather strange cat (some say dog)-looking animal clinging to someone's back, and begins pursuit. This can't end well..
-
"Anarchy" gets up, seeing somebody chase after him he keeps running..... Not looking where he is going....
Then he runs into something...
Ow! What is this? A foot? What?
"Anarchy" looks up, it is indeed a foot, but not just any foot, the foot of a Gundam.
Gundams? Here?
He then looked at where he was...
"FRIENDS OF THE RACERS LOT"
He looked, sure enough there were some.... oddities...
Lets see... Gunmen, Gundams, An Entry Plug? Vespa... Large Space Boats... Oh [parasitic bomb].
Sitting a few spots down from where "Anarchy" was standing, a Pink Jeep.
"Anarchy" pulled the eye out again.
SCANNING....
SCANNING....
TWO MATCHES FOUND.
-_-, Time to go!
"Anarchy" Ran off quickly.
Hm, didn't expect to have such a crowd. I really should be more careful on where I Jump. Or more importantly, who I give Jump Drives to.
-
Gaia then skids to a stop, only to notice a Gundam.
"... AWW [parasitic bomb], NOT AGAAAAAIIIIIIN!" After recalling the last mishap that involved a Gundam. He then continues the pursuit of the yapping dog/cat thing.
"Tell your cat to shut up!" He yelled at the stranger he was persuing, still intrested in the green cat/dog thing.
-
"Anarchy" Yelled at the person chasing him.
Its not mine!
-
"Then try shaking the thing off!" Gaia yelled at the man.
-
"Then try shaking the thing off!" Gaia yelled at the man.
"Anarchy" managed to get chuck off of his cloak, but not before chuck got a small bit of fabric from it.
Already happened.
-
Then.. it shall be.. REEETTTCOOONNED!
"Hey, can I have some of that fabric on ya? I'd like to do some studies." Gaia was intrested in the green fabric on his cloack. Intrestingly enough as that thing apparently stopped yapping, which was messing with his sensors earlier.
-
Oh, this? Here.
"Anarchy" handed the green fabric to the man.
Oh, before I forget. If you see a Blonde and a Goth Girl, tell them I'm not here, will you? I've done something pretty bad and I accidentally left them a way to find me.
Then.. it shall be.. REEETTTCOOONNED!
Seems to be a recurring theme in this installment.
-
Gaia gave him a tip shortly after. "Hey, if they have heat-seeking devices, hide your heat signature if you can. See you around. And promise me, I'll keep my mouth shut. Since we are far away from them right now, yeah."
Shortly after, he left to return to the seats making sure his favorite seat wasn't taken.
Seems to be a recurring theme in this installment.
Well, looks like everyone's not up to snuff lately, with the account to the currently billion RPs active right now..
-
"Anarchy" continued to wait, for curiositys sake he decided to peer into the crowd to see the people who attended.
Oddly enough, there were individual bleachers, each for a designated racer's fans, split into the two divisions: Sparkvernia and RPM. On the RPM side there was a noticable bleacher that was Empty, the name was mostly gone, all that could be seen was:
AME
"Anarchy" looked over at the bleacher for his fans (Also on the RPM Side.), compared to a lot of them, his was rather packed. He recalled the "FRIENDS OF THE RACERS LOT" being filled with oddball vehicles, and this was exactly why.
From his Dimensional Travels, courtousy of his Jump Drive, you don't really need to know how he made this do you? I mean, he invented [tornado fang]ing Time Travel just to stop him from doing something that eventually lead to a massive time travel incident! Demensional travel should be like a compliment to that! :V
Sure enough, he could see some people he recognized, He caught sight of the Evangelion Pilots, sitting in their casual attire. The crew of the Bebop, sitting in the back, Even Team Dai-Gurren and the Black Knights had come to watch him, he looked into the box and noticed a few people, sticking out the most were Zero and Gendo Ikari (Why he would come is beyond anybody, maybe they brought evangelions?).
What stuck out most though, was a special few seats up front. Two of them were vacant, but the next two were occupied by the two people "Anarchy" had been trying to avoid ever since he saw "Master G".
None other than Panty and Stocking.
"Anarchy" Froze, his face looking kind of like he choked, why would they be here? In fact, why would anybody be here?
Simple, "Anarchy" made multiple jump drives, and gave them to the friends he had made during his travels, with the offer of Visiting, they all just happened to get a convenient message telling them to stop by today in particular.
Panty and Stocking... on the other hand... lets just say "Anarchy" got into a sticky situation and as he was leaving dropped one of the jump drives. -u-'
"Anarchy' slowly crawled back behind the entrance gate.
[Delicious Backstory! Delicious Filler, Delicious Cameos! All of this and more for a paltry paragraph!]
-
Gaia noticed someone familiar, it turned out it was the guy in the robe from earlier that he was pursuing (by that he meant chasing CHUCK). "Hey buddy, nice seeing you again, but I don't know about this, but I think I've met you once during one of my mining trips. ZX-Kun.. was it? Yeah, probably so. My scanners can recognize 1000+ folk. And with the robe I can still recognize your face. The sensory chip also updates your identity, here, have an empty seat next to me, it's time we'd catch up.."
(In plot consistancy, Gaia actually DID meet with ZX "Anarchy" in one of the previous story arcs, technically, with this arc, he's become a demon hunter, to keep up with the theme since his Drillstation broke sometime ago in one arc, and he badly needs cash for repairs)
-
"Anarchy" decided to keep his cloak on, but adknowleded the man's request and sat down.
So you know who I am? Didn't think this disguise would fool anybody, and I was right. Everybody seems to know who I am despite the fact that I am legally dead. Dimension jumping can do a lot to a person. Thats why I burned my house down and made people believe I was dead. I decided I didn't want to live the life of a rich Gary-stu and decided to be a more standard fighter. Of course, getting Weapons from the Universe of Legends helped.
So, how's life?
-
Rankiryu just about fell off his platform in shock as the four students holding him almost collapsed from the near impossible addition of weight.
"Ack! Wh-What the...!?!?" he wails, almost seeming to act like he didn't recognize the new arrival.
Temnota landed safely on the ground.
"Mr. Pilot cap, that was kinda unmanly of you to get scared like that."
Said the Iron chef.
(HEEEEEY STTTTTT! LET'S GET THIS STARTED PLEASE)
-
Temnota landed safely on the ground.
"Mr. Pilot cap, that was kinda unmanly of you to get scared like that."
Said the Iron chef.
(HEEEEEY STTTTTT! LET'S GET THIS STARTED PLEASE)
[He said that something came up, I think we're going to have to wait a little longer.]
[Sorry this RP hasn't even really started guys, some things came up that holds me from getting this show on the road. Hope you guys can wait a bit longer.]
-
(I know)
-
(I know that, but hoping it will start up soon will just make feel like its taking forever. Might as well have some filler to ease the anxiety.)
-
"Anarchy" decided to keep his cloak on, but adknowleded the man's request and sat down.
So you know who I am? Didn't think this disguise would fool anybody, and I was right. Everybody seems to know who I am despite the fact that I am legally dead. Dimension jumping can do a lot to a person. Thats why I burned my house down and made people believe I was dead. I decided I didn't want to live the life of a rich Gary-stu and decided to be a more standard fighter. Of course, getting Weapons from the Universe of Legends helped.
So, how's life?
"Of course, thanks to the power of machines. But I don't let that overcome me, or I might wind up tech-dependant. It's called moderation ya know? And I see. The Drillstation's actually built from stolen wreckage, ya know, so each part has a history behind it.
Speaking of which.. Last time I saw you without the robe was.. The Ruby Spears incident? I'm sure I was minding my own business up to that point, later the drillstation itself was launched. I can't imagine what the Sparkervanian Badlands' security is like without it's leader, back then it was filled with all sorts of traps!"
As Gaia continued on (to the point where he can make a person fall asleep just listening to him), the Black Hole that plauges the closed-off areas of RPM begins to abruptly spewering demonic ghosts of all sizes and shapes. The leash was none other than.. A Wily II clone?!
(HEEEEEY STTTTTT! LET'S GET THIS STARTED PLEASE)
(Ahh, that's life for ya. Enjoy the ghostbusting filler to ease ST's absence.)
-
Ah yes, the Ruby-Spears incident. I think I mainly was a background character in that part. It was kinda fair considering how I was the one who accidentally sent everybody back in time. I think I was just chilling out. Last time I was truely in action at all was when that Black haired guy took over RPM. It was after that when I decided to start my Demension Jumping... Had some good times, if you wanna hear about them.
-
"You know, that would be intresting. I'd love to see what the other RPMs were like, that would be intresting." Gaia was intrested about the dimensional trips, unaware of the horde of rabid ghosts rampaging all across.
(again, just giving a filler scenario here. :x)
-
I've never traveled to different RPM's. I usually use a world base as my jump destination, hence why you see that crowd over there.
"Anarchy" Points to the bleacher with his name draped over it.
You see the people over there? Those are people I ran into during my dimensional travels. I've been acquainted with them. I guess you could say I'm the worldly type. XD
They're all people I know, become friends with... and loved in a specific case. Never traveled to a different RPM, don't want to really. I could see something that would make me want to stay but in the end wanting to kill myself for the fact that I've been stuck in this reality. Where as another reality could have me much happier.
-
"I see. I guess that explains the nudebots going crazy. You left a wormhole open that left a gateway to untold horrors, bad idea. Speaking of which, since I've taken notice you've been trying to avoid -this one guy-, does that mean Daten City's around the other side of the globe, since this is basically several diffrent universes crammed into one planet?"
Gaia now felt curious how each incident began, and not knowing that half of Daten City's enraged ghostly residents have been making a lot of noise nearby..
-
Temnota landed safely on the ground.
"Mr. Pilot cap, that was kinda unmanly of you to get scared like that."
Said the Iron chef.
"Unmanly!?!?" Rankiryu exclaims before scrambling back to his original sitting position, "There's nothing manly about being caught by surprise! it happens all the time!"
He finishes with a mighty laugh that only insinuated to everyone just how hesitant he was in trying to think up an excuse to protect his pride.
-
"I see. I guess that explains the nudebots going crazy. You left a wormhole open that left a gateway to untold horrors, bad idea. Speaking of which, since I've taken notice you've been trying to avoid -this one guy-, does that mean Daten City's around the other side of the globe, since this is basically several diffrent universes crammed into one planet?"
Gaia now felt curious how each incident began, and not knowing that half of Daten City's enraged ghostly residents have been making a lot of noise nearby..
Actually, I didn't settle in RPM until after the nudebots... even though I think I ended that. Maybe I did cause most of the events that took place? Anywho, I've taken my time avoiding those two because of my travels in Daten City. I wouldn't say this planet is a multitude of Different Universes. There are what I call "Gates" however. Areas in this globe that contain a similarity to things in an alternate universe.
"Anarchy" points to that large white Monolith.
See that? Its a gate that resembles the Main gate of Kattelox Island, I traveled there not too long ago. Hence where I got this.
"Anarchy" unsheathes the Machine Buster he took from the Kattelox Support Car.
I took a lot of weapons in order to give myself an edge on this race. I've taken usually a small souvenier from each place. Usually its just a picture of me and the friends I made along the trip. My Daten city trip I took something different though. And no, before you think its that its NOT that. Jeez, i'm not a filthy pig or anything. :P
Anywho, those ghosts out there? Yeah, pretty sure they took the entrance in from my Daten Trip. Can't be destroyed by conventional means, Only modified weaons or angelic weapons will kill those. Thankfully mostly every person in RPM has a modified weapon of some sort.
-
"Huh, intresting. Gates, as in the Gates seen in Super Robot Wars? Neat, didin't know we had those out there. Also, thanks for the help with the Nudebots. That was some crazy finale. And now, can we kick some ghost ass for the time being before "they" do?"
Gaia suggested that, while the ghosts were on a rampage, kick ghost ass while he and RMZX are waiting for the race to start. And besides, it's part of his new job as ghost hunter.
"Also, please seal each gate next time so rampaging enemies from various dimensions come crashing in again, I think you left a few open.."
-
Trust me, Kicking ghost ass sounds fun. But those two will find out quickly, I think they've been watching me. And please, RMZX is dead. Call me "Anarchy". Lets go.
"Anarchy" jumped off the bleachers and ran towards the disturbance.
Also, gates usually seal themselves. Those guys have duplicate jump drives so they can attend the race.
-
"Heh, I'll stick with Anarchy bros. for a while. What's our first target?" Asked Gaia. "And Dupligate Jump Drives? Intresting. I guess this is gonna be the first time having a mob from another dimension attack this one, I've been practicing a few moves."
-
Lets take out that group that looks like they're stoned. Easy Pickings to see if these weapons even work.
"Anarchy" did a somersault into the air and Produced the Powered buster from hammerspace. Within a few seconds he was able to get locked on, and fired....
But the ghosts were already gone.
What?!
"Anarchy" landed, looked around. There were what looked like small craters where the ghosts were.
In those craters were small coins...
Welp, I think they beat us to the draw.
You bet your ass we beat you!
"Anarchy" turned around. Sure enough, the Anarchy Sisters were standing there.
So. Its you. Do you want my head?
Please, what I want to know is why the hell you're even here!
Because... I live here?
You know, he isn't a ghost, so why are we bothering with him?
Because I'm still frustrated about what he did!
What did I do, exactly?
YOU KNOW FULL WELL WHAT YOU [tornado fang]ing DID, DUMBSHIT!
Panty, just settle down. Jeez. All I want to do is sit down and finish my snack.
Yeah, Yeah, Stocking.
Snack? Here, take this.
"Anarchy" handed Stocking a package.
Inside of that are some of the best sweets known to this universe. Enjoy.
Oh, um... Thanks... RMZX...
He is dead, I go by "Anarchy".
OH SO YOU STEAL OUR [tornado fang]ing NAME NOW? You really have a nerve, don't you?
Whatever I did I apologize for, enjoy the race, Stocking.
"Anarchy" walked back, the rest of the ghosts would, unfortunately, be taken care of by Panty and Stocking, due to the over-extravagance of "Anarchy".
-
"Errrm, what did I miss?"
Gaia arrives where the ghosts were once at, but he was beaten to it. He returns to his "seat" to try and find his friend.. if he can find him.
-
You should probably sit in the "Anarchy" Fan Seating. You are my friend after all, right?
-
"Huh, that's a good idea. I'll probably get a better view there of the race." Gaia then moved up to the Anarchy seating. Hopefully not next to demons.. as it will make his demon/ghost-hunting job harder.
-
Trust me, no demons are my friends. Though you might wanna be careful around the Black Knights and Team Dai-gurren, they just ordered a LOT of alchohol and are getting wasted. Best Idea would be to sit between Ms. Haruhara and Mr. Speigel. They're a little nuts, but its better than sitting in the seat next to Stocking. Because she might hurt anybody who goes near her sweets.
-
"Ehh, these nuts? yeah. I might try take that vacant spot where it's in a safe distance away." Gaia then sits himself down in a chair between two other unoccupied chairs.
"These aren't reserved.. aren't they? *gulp*"
-
Hmm... the only people missing are...
Master G and Chuck, who we saw outside.
There might be more people later. but I don't have a guest list so its not like It matters!
Oh, and don't ask why I was nicer to stocking than I was to panty back there. Its not something I really want to talk about.
-
"Still, it's strange enough that we have angels, yet no demons show up. When they do, things are really gonna get crazy in here."
Gaia, who spoke in an rather uneasy tone.
-
They cannot get into here. The Ghosts can, but the demons are locked out because of the portal specifications, Simply put. No Demonic hellspawn allowed through.
-
"Ah, good. I was getting rather worried there, that they might try to disguise themselves as normal people.. or worse, find a way to travel with an artifical gate.."
Gaia sighed in relief..
-
"Unmanly!?!?" Rankiryu exclaims before scrambling back to his original sitting position, "There's nothing manly about being caught by surprise! it happens all the time!"
He finishes with a mighty laugh that only insinuated to everyone just how hesitant he was in trying to think up an excuse to protect his pride.
"No..no it doesn't. Anyways you sure did walk a distance to get here. Are you interested in enterring?"
-
[Responsibilities, illnesses and all that RL jazz can be a pain in the ass. Now then, where were we...?]
Whilst all hell broke loose around the starting gates of the race. Nekolyan came back with his vehicle...a very rusty looking bicycle.
"Nyaaar. Well I should be a bit impressed with myself. I made this thing using some rocks, a few sticks from the ground, aluminum wrapping paper and string. Though I was hoping I would have made a kid's hovercraft, at the very least." The cyborg mumbled to himself.
Unbeknown to Anarchy and Gaia, the cloaked femme fatale who put up the fliers, was spying on them. Though she quickly went back to her spot in the starting point of the race.
----------------------------------------------------------------------------------------------------------------------------------------------
ALL RIGHT RACERS!! The clock has stopped ticking
and the Grand Race of Fate can FINALLY BEGIN!
All racers better be in the starting line now
or they shall be disqualified immediately!
"But before all of that...Who the hell are all this muscle headed joc-gentlemen that are marching in the racer's way?" Mr.Hatter said, a bit annoyed.
"You men better be here to participate, or else I'm going to have to tell you all to kindly get the f-move out of the way. There is a very, very important event going on here that has the fate of RPM hanging in the balance." He said in a kind manner, or as kind as he could do.
-
Ah, theres my queue. Wish me luck, everybody!
"Anarchy" shuffled to the starting point for the race. Keeping in mind not to unveil any more of his tricks.
[Oh guys, when mentioning anarchy please be sure to keep his name in quotes. As technically his real name is RMZX, he just doesn't go by that anymore.]
-
"HEY GUYS, GET OUT OF THE FREAKING WAY! I'M TRYING TO WATCH A RACE!" Gaia yelled at the men blocking the racers.
-
Despite all the commotion aimed at the momentarily halted parade of straight-walking men, Rankiryu managed to overhear the reason there were so many people sporting varied brands of vehicles, as well as the coordinator yelling at them to participate or move out of the way.
"Hm, that all depends," he says with a greedy smirk on his cylinder-shaped head, "Will there be a wealthy prize at the end of the finish line?"
Most of the First Years just glared at him in annoyance, knowing he'll participate anyway just to give them a hard time for that vengeful prank they pulled on him last week.
-
"The price you ask? Why it's nothing really, just the entire nation of RPM. No biggie." Mr.Hatter told the iron bodied teacher (?), with a cheery tone.
"At least till we find our missing President and Vice-President, the scantily dres-beautiful, kind and well, well dressed, Vixy. And the overly bearing eg-master of charisma and PBness, PB! Course we haven't heard anything yet."
Mr.Hatter then had a fuddled expression on his face.
"In fact no one has seen any of the big wigs that run RPM since the we were all teleported to this new, seemingly same world."
[Question, if Vixy's the prime leader of RPM, PB the co-leader. What positions do the rest of the admins/mods have? Just a random question really, could improve the writing of this story. Maybe.]
-
"Unmanly!?!?" Rankiryu exclaims before scrambling back to his original sitting position, "There's nothing manly about being caught by surprise! it happens all the time!"
He finishes with a mighty laugh that only insinuated to everyone just how hesitant he was in trying to think up an excuse to protect his pride.
"..." Waddle Dee faced palmed and rested the staff on his shoulder for a bit.
Afro, Afro-Man, and A.Silan finaly perked up as they heard the announcement.
""Is it me or did the past few hours feel like weeks?" Afro asked, scratching the back of his head.
"Beats me....this RPM of yours may seem more peaceful then ours but...its more chaotic at the same time...What do you think chief? " Afro-Man asked A.Silan.
Else where behind them, Agent J was ready with several other contestants. "..."
-
Since the race has been sorta delayed by people, "Anarchy" decided to appeal to his peanut gallery.
So... Stocking, wish me luck?
Yeah, sure.
Listen, after the race, wether or not I win. I'll take you to the best sweets store in the city? How about it?
Sweets? Ok, Sounds good!
Hey, do me a favor. See if you can get your sister to get those men out of the way?
Panty overheard this.
MEN? Where?
"Anarchy" Pointed to the group of people.
Within micro-seconds Panty was gone into the crowd.
-
Blackhook looked over to ST
"Well, it looks like the race is starting, let the better of us win"
He said and headed for the start
other racers were also getting ready.
"If you want to join, you just have to fill this papers!"
Temnota handed Rankiryu the documents needed to enter.
The four knights were prepared for the race, when suddenly a commotion caught their eye. A blonde woman was molesting the male audience. The male mambers starred at the blonde-Panty, while Stolz went ahead to clear things up. She teleported right next to the lustful woman and grabbed her by her hair, then she dragged her ouside the group.
"Where do you think are you now? Such behavior won´t be tolerated so would you kindly leave this place?"
Demanded Stolz.
-
Blackhook looked over to ST
"Well, it looks like the race is starting, let the better of us win"
He said and headed for the start
other racers were also getting ready.
"If you want to join, you just have to fill this papers!"
Temnota handed Rankiryu the documents needed to enter.
The four knights were prepared for the race, when suddenly a commotion caught their eye. A blonde woman was molesting the male audience. The male mambers starred at the blonde-Panty, while Stolz went ahead to clear things up. She teleported right next to the lustful woman and grabbed her by her hair, then she dragged her ouside the group.
"Where do you think are you now? Such behavior won´t be tolerated so would you kindly leave this place?"
Demanded Stolz.
Hey [sonic slicer]! Get your damn hands off me!
Panty pulled out her gun, Backlace, and held it up to Stolz' Chin.
She fired.
No Effect.
Oh, guess you're not a demon... -u-'
Panty made an embarrassed smile, patted Stolz on the head, and ran off, taking a portion of the Male Audience with her (She'll be back, trust me.)
-
"...she insulted me..and attacked me...I take that as open rebelion."
Said Stolz with an mishievous look in her eyes. Her armor changed form and became the Fx-variant, equipping the knight with two oversized guns.Though before she could fire she was stopped by Sieg.
"Owww...you alwys ruin my fun..."
-
"H-Hey! What the hell are you doing lady?!" Gaia noticed he was swept off the seats by a crazy lady. He also in a vain attempt try to break free from the crowd and flee, but no avail.
"Gah, I hate these types of scenarios where I have to detach!"
Gaia then disassembled himself, only knowing the chest part was the cockpit to a rather.. surprising pilot.. a 2 inch., 4 kilo. wide anthrophobic roach.
"God, NEVER AGAIN!" He then vowed never to do this in human public, as he is from a roach-infested alien planet, and this is a Z-32L body type used by explorers, hunters, and the like. The model he wears is the "Soldier" type used for combat. Inside the torso there is a slot for folks like him to insert himself into and take control of the armor, and he disguises himself as a human under the helm very often to hide his true self. A pathetic, harmless, roach. nothing more.
He only lied to many that he is a robot created by a doctor that was left behind in a factory, no more, no less.
-
"GOOD LUCK TO YOU TOO CAP'N CRUNCH!!" ST blurted out before he dashed off on his motorunicycle to the starting line.
The racers that stood their ground when the marching muscle students came to the starting gate also prepared themselves for the race. Starting their engines and warming up before the race could begin. Of course some were getting a bit impatient, the hour seemed to last for a month, and now the race is being delayed by the very same marching students. They now wait for the hosts of this race to quickly fix this problem.
In other news...
"Um, Clockston. Can I ask you something?" Sally asked her parental guardian/mentor.
"What is it, dear Sally?"
"Well I was just watching the audience for a minute when some blond lady came out of nowhere and started...well I'm not sure what it was." She said a bit confused.
"Sally, if you are going to ask me what those undignified rapscallions were doing, my answer is "I'll tell you when you are older"...and we shall leave it at that." He said, almost as if he were scolding her.
Right next to them was their general with the opera mask, who told Nightmare Sally.
"It was sex, Sally. A gang on girl orgy to be exact, and as much as I would like to share more of my knowledge about the subject with you, I'm afraid we must focus on the race." He said, in an all too serious tone.
"G, General! How can you say such things in front of Sally!" Clockston shouted at his superior, trying to cover the girl's ears.
"...But what's an orgy?" She asked curious of what she had just heard.
"I SAID I SHALL TELL YOU WHEN YOU ARE OLDER!!" Clockston exclaimed.
"Clockston, she is 13 years old, I believe she is old enough to have that sort of talk." He calmly explained.
"B, But, we don't know if her species last longer then ours. What if she is just still a baby in her people's case!" Clockston said, a bit teary eyed.
[Where's WhiteJet?]
-
"Anarchy" stood at the starting line, Looking determined, He turned to his crowd and gave them a thumbs up. They applauded, Stocking on the other hand blew a kiss to "Anarchy". What could this mean? Panty also returned, wearing different clothing and a hat.
"Anarchy" held up a sign that he pulled from his hammerspace cloak.
"YOU WERE SUPPOSED TO GO AFTER THOSE STUDENTS!"
Panty Held up a sign:
"YOU DIDN'T TELL ME THAT!"
"Anarchy" Sighed. Then he addressed the rest of the racers.
Alright, if we want to get these meatheads out of our way, We need to remove them by force. Anybody have a giant version of those Robots from Mario 64 that threw you when you were on their scoop? Or a Catapult to launch them off of?
-
Rankiryu smirks rather sadistically as he takes the forms and fills them out to the chagrin and annoyance of the other students. What started as another boring exercise has now become a competition for the selfish satisfaction of their current instructor. He hands the forms to Temnota before looking down to the mentally aggravated students.
"Alright, you maggots! Find a gap and form a line! We're showing these wimpy chumps how real men win a race!"
Most grumbled in annoyance as they clamber towards an empty gap in the line and awaited the start of the race. Rankiryu looks towards Waddle Dee with an even wider smirk on his face, "Since you've done such a good job of leading this march so far, why don't you do the honors of being the hood ornament that guides us through the easiest of paths?"
-
*Gaia reassembles his armor*
"Good, now that I'm back together again, now to deal with those people.. hmm.. I got it! Chaarrrgeee shooooott!"
*BLAM!*
Half the people blocking the road were blown away by the blast. It appeared his power gauge on the buster wasn't high enough. Now it might take another few hours to recharge for a super blast..
-
Rankiryu smirks rather sadistically as he takes the forms and fills them out to the chagrin and annoyance of the other students. What started as another boring exercise has now become a competition for the selfish satisfaction of their current instructor. He hands the forms to Temnota before looking down to the mentally aggravated students.
"Alright, you maggots! Find a gap and form a line! We're showing these wimpy chumps how real men win a race!"
Most grumbled in annoyance as they clamber towards an empty gap in the line and awaited the start of the race. Rankiryu looks towards Waddle Dee with an even wider smirk on his face, "Since you've done such a good job of leading this march so far, why don't you do the honors of being the hood ornament that guides us through the easiest of paths?"
[Wait, so you're saying all of your school people are in this race too?]
-
(Yes)
-
(Yes)
[Alrighty then.]
Seeing as the meatheaded student-type people have now joined into this race. "Anarchy" prepped himself for the inevitable "READY...."
-
"Ok boys I wish you good luck and if you do fine I will cook you your favourite dishes!"
Said Temnota to motivate the Otokojuku students, some of them even started drolling.
Silan left her tent, her four knights were already standing besides her. They walked over to Mr. Hatter. Silan sat down on a throne that was prepared for her.
"Now Mr. Hatter, it seems that we can officialy open this race..."
A. Silan, who was wearing a metalic Gargoyle mask, so that people won't point out her similiarity with the Leader of Sparkvenia, answerred Afro-man's question.
"I'm not quite sure what to think of this place...but I've noticed that my alternate me is very different from me..."
-
While nobody was looking, "Anarchy" set up a list of people:
ALLIES:
RPM-Racers
ENEMIES:
Sparkvernian-Racers
Students
Odd Teacher person.
After he finished he quickly pulled out the Red Eye and attached it to his cloak, allowing him to scan the area for possible shortcuts.
Lastly, he stretched out, equipped his jetskates to his shoes, and made sure his armor was properly held up. As one last thing, Stocking called out to him:
HEY! TAKE THIS!
She threw something at "Anarchy", he caught it without looking, he looked at it and saw that it was a small coin, for good luck perhaps? While that happened he noticed somebody shoving something into his cloak. He checked and noticed a nice Katana had been slid into his cloak. [Its not Stockings, just a regular Katana.]
-
"Kyo ho ho ho, of course princess."
Mr.Hatter took the center stage, clearing his throat before he could properly start the race.
He drank a tall glass of water, and with booming voice, he gave the speech.
WEEEEIIIIILLLCOOOOMMMEEE EVERRRYYYYOOOONNNEEE!!!
WELCOME TO THE FIRST EVER, RACE OF DEEESSSTINYYYYYY!! THE ONLY RACE IN THIS WORLDS HISTORY
WHERE THE FUTURE OF AN ENTIRE COUNTRY RESTS ON THE HANDS OF WHICHEVER INDIVIDUAL
IS VICTORIOUS IN THIS EVENT!!
THE ONLY RACE WHERE SMALL TIME NOBODIES CAN QUITE LITERALY
CAN BECOME A KING AND/OR QUEEEEENNN!!!
But this is not about you folks.
THIS IS ABOUT OUR VERY FREEDOM AT STAKE!!
BUT NOT ONLY FREEDOM, THIS.
IS A RACE.
OF VALOR.
A RACE OF CHARACTER!!
ONE THAT WILL TEST YOUR SKILLS, DEXTERITY, STAMINA, YOUR VERY WILL!!
THIS IS THE RACE OF DEEESSSTINNNYYYYYYYY!!!
I AM YOUR FANTAAABULOUS HOST, MR.HATTER!!
Now some of you may be asking, 'Mr.Hatter, just what is the Race of Destiny?
WELL I'M GLAD YOU ASKED!
THE RACE OF DESTINY IS NOTHING MORE THAN A LONG AND VIGOROUS RACE,
ACROSS THE ENTIRE CONTINENT OF RPM AND THE VERY BORDERS OF SPARKVANIA!!!
RACERS SHALL RIDE WHATEVER THEY CAN
, or in some cases run,
THROUGH OUT 9 DANGEROUS TRACKS.
ALL OF WHICH ARE A DISTANCE OF BETWEEN 250 km (150 miles) TO 10,000 km (930 miles)!
Roughly speaking of course, this includes curves, loops and all such obstacles.
HERE ARE THE RULES RACERS:
All racers must only use the vehicles they have started the race with.
It is COMPLETELY prohibited to change vehicles inbetween the races.
If your vehicle is damaged, you may try to repair it,
but it must be repaired before the first racer reaches the checkpoint.
If you fail to do so, the racer shall receive a demerit.
3 demerits and you are DISQUAAALIFIIEEEED
You cannot steal another racers vehicle, doing so will get you automatically DIIISSSQUAAA;IFIIIEEED!!.
But don't worry, If the last racers are still fine, but are taking to long to pass the finish line.
Our Lakitus shall be kind enough to give you a lift.
However, if this were to happen, this means the racer in question will get a demerit.
3 demerits and it's BYE-BYYYEEEE!!
Attacking other racers is prohibited, but if the racer in question is outside of his vehicle,
the one who has dealt harm to the individual shall be disqualified.
SAYONAAARAAA RACER!!~
Teleporting gets you automatically kicked out of life.
...
NO EXCEPTIONS!!!
Now then, this race runs on a point system.
Racers shall receive points depending on the order of racers that passes the finisg line.
1st place gets you 250 points.
2nd place 150
3rd place 75
4th place 50
5th place get 25 points,
all othes shall get 24-0 in the order of their arrival.
What does this mean,
That even if you didn't get first place in every track,
if you have enough points. You ARE to be the victor.
And to make things more interesting, each track shall have special challenge
which counts as 250 extra points to the total score of whichever racer can acomplish it.
Not only that, but there is a special token in each track that are worth a whopping 500 points!
Of course, the token won't be easy to find, but keep an eye out for 'em,
'cause trust me, they'll be worth the trouble!
I would also like to point out that the bratt-lovely Empress Silan's vassal, Temnota, and her babysi-
Four Fearsome Knights shall referee the whole race. And for your viewing pleasure,
we have some lakitus that shall record all the juicy action in which our audience shall see,
right in the comfort of their own seats on that gigantic HD monitor.
Violence has never been clearer folks!
Now then, are there any questions before we begin?
"Actually I do. Where-"
TOO LATE!
ON YOUR MARKS!!...
GET SET!!...
The tension and excitement rose in the audience, as the racers started their engines and made their final adjustments. After a long delay the race was about to begin.
Are the racers on RPMs side ready to undertake the trials that awaited them? Will Sparkvania finally expand it's land towards the north and create a kingdom ruled by Silan's iron fist?
Is Flame getting a massage in the Nekocafe? Where is Waldo are the leaders of RPM.
Perhaps the answers lie, in the coming chapters of;
RPM Battle 'N Chase!!
-
[Wait, what? Aww man, I was looking foward to trying to attack people and have them godmod-dodge all the time. :P Oh well, at least I cannot be attacked.]
"Anarchy" Quickly Revved his Jetskates, popped in some Sonic Music to get his body ready, and impaitently waited, modifying the scanners on the Red Eye to pick up hidden medals.
-
Rankiryu jitters anxiously on the metal platform held by four of the large First Years who have unfortunately been entered into the race. Though disappointed that the students won't be able to do anything to detract the competition, just seeing them get pummeled by the many vehicles was all he needed to make better men out of them.
Having heard that the race was about to start, Ryuta tosses the manga he had been reading into the compartment in his ride chaser and takes up a driving position, revving his throttle in preparation for the cue. Tango, meanwhile, seems to have fallen asleep in his Lakitu cloud, finding the fluffy interior too comfortable to stay awake and notice that the race was about to start.
-
Gaia, knowing him, begins to scan the track for any anomalies that he might come across, and might be considered cheating.
"Is this supposed to be a deathrace? I doubt anyone's gonna pull a Sebulba and cheat his way through the entire challenge.." Gaia thought to himself, thinking of the possible chance of cheating.
-
[Anybody think its a good Idea to make a list of Characters in this RP Aside from the Secret Files and Origins Topic? A nice list of the races would be nice too. :)]
Posted on: February 27, 2011, 08:20:05 PM
[Also if nobody minds I'm going to include "Anarchy Archives" in my posts during the race to flesh them out a bit. What they'll be is either accounts of my travels through the dimensions I've been through, Historical Documents with events from Busy World 1 through my eyes, or simply random little entries that I hope to use to flesh my character out. Of course, if people don't like the Idea I can just not do them.]
-
The sparkvenian allstars and multiple unnamed sparkvenian drivers were getting ready for the start.
Blackhook was leaning leisurely inside his little ship, awaiting the start.
A. Silan and Afroman were also ready.
-
Oh, before I forget,
Racers who have no vehicles and are participating on foot
in this event. Said racers shall be considered vehicles themselves.
Much like if a racer is on a riding animal,
the animal in question is considered that racer's vehicle.
As for the destination of the first track,
can't have you guys going in circles now can we?
The race starts from this very plaza,
through the south eastern streets of the city,
and ends in the first checkpoint,
which is located right in the vicinity
of some old ruins.
That should be a good warm up for all of you.
Racers can take any route they wish,
However, just for this occasion, we took the liberty
of blocking some roads with some special, undetectable walls.
With that said...
Oh yeah, one more thing racers.
Each one of you is required to wear
these nifty little badges, just so our
referees can know where you are at all times.
You can never be too careful!
The Lakitus and other crew men working for Mr.Hatter gave each of the contestant one of this special tracking badges.
Now then...
GOOOOOOOOOOOOOOOOO!!!!
[spoiler]List o' Racers
RPM Racers
-Ryutta [White-Jet]
-Tango [White Jet]
-Blackhook [Blackhook]
-ST (aka. Strange Man) [ST Jestah]
-Anarchy (RMZX Anarchy)
-Nekolyan [ST Jestah]
-Brocky Bulldawg [ST Jestah]
Sparkvanian Racers
-Hobo Franken [ST Jestah]
-A. Afro [Afroshroom]
-A.Silan [Afroshroom]
-Adante Van Bethin [Blackhook]
-The Spark 6 [Blackhook]
-Turbo X540 [Blackhook]
-Sachertorte [Blackhook]
-Hermescus of Owleye House [ST Jestah]
-other sparvanian racers[TBA, mostly Blackhook though]
Rankiryu's Muscle School (feel free to quote me on the name White-Jet)
-Rankiryu
-other students [Maybe]
Others
-Clockston and Nightmare Sally [ST Jestah]
-Crimson (guy with an opera mask) [ST Jestah]
-Agent J [Afroshroom]
-Bishoujo Caveman [ST Jestah]
-Garm Dasce [ST Jestah]
Total of racers = 500 (Most of them are cannon foddler so blow them up whatever way you see fit).[/spoiler]
-
[Ah, much thanks, it'll help me determine who to antagonize and who to ally with.]
Anarchy fired up the jetskates and Unsheathed his Machine Buster. The jetskates were slow at first, but the speed picked up quick due to the enhancements Anarchy had given them. He quickly broke free from the group of sameface generics and took the lead. His crowd cheered.
ALRIGHT! SHOW THOSE ASSHOLES WHO'S NUMBER ONE!
GOOD LUCK!
Then they all said Simultaneously:
WE SUPPORT ANARCHY!
ANARCHY ARCHIVES #1: Time Travel
"Today I was socked in the face by some guy saying that I wrecked his home. Maybe It wasn't a wise Idea to fire a large laser at a department store without thinking of the possible consequences. At least this gives me an excuse to use my Time Travel equipment, how it works is similar to the Epoch from Chrono Trigger, it allows me to travel through time provided I have set a coordinate date into the device. I shall go back an hour and move the Department store so that my bruises will heal, I mean, whats the worst that could happen?
-
As Gaia watched from the stands, he shouts along with the rest of the supporters:
"ANARCHY! KICK THEM ASSES!"
-
Suddenly BH's little ship effortlessly overtook 'Anarchy'. The pirate captain looke over, waved his hand and took the lead.
The Turbo X540 transformed into tank mode and fired some missles at the RPM competition.
Adante followed by the Spark six easily overtook Anarchy aswell.
Other racers have been close to eachother
-
Rankiryu smirks rather sadistically as he takes the forms and fills them out to the chagrin and annoyance of the other students. What started as another boring exercise has now become a competition for the selfish satisfaction of their current instructor. He hands the forms to Temnota before looking down to the mentally aggravated students.
"Alright, you maggots! Find a gap and form a line! We're showing these wimpy chumps how real men win a race!"
Most grumbled in annoyance as they clamber towards an empty gap in the line and awaited the start of the race. Rankiryu looks towards Waddle Dee with an even wider smirk on his face, "Since you've done such a good job of leading this march so far, why don't you do the honors of being the hood ornament that guides us through the easiest of paths?"
Waddle dee stared at him,"..." if he had a jaw it would drop in disbelief. He flailed in disagreement but was easily palmed like a basket ball and was smacked down onto the front of the group, as a hood ornament and now 'navigator'. "..." he sobbed on his hands ans knees and gloomed down...but still held onto the flag staf firmly.
A. Silan, who was wearing a metalic Gargoyle mask, so that people won't point out her similiarity with the Leader of Sparkvenia, answerred Afro-man's question.
"I'm not quite sure what to think of this place...but I've noticed that my alternate me is very different from me..."
Afro-Man nodded,"I...belief I can say the exact thing abiut me." he said sighing and looked over to Afro.
'o3o?' "...?", Afro blinked.
As soon as A.Silan, Afro-man, Afro and Agent J put thier badges on, they were ready to blast off as soon as the race started.
As they race started, J, Afro-Man and A.silan zoomed off, catching up on Black Hook and anarchy. The waddle Dee suddenly snapped up and, if he could of, 'shouted' and pointed forwards.
Afro's cart had stalled,"Ack...Damn you rocket start timing!" he swore as he then zoomed of to catch the others.
-
Hearing the mark, Ryuta pins the badge onto his armband and hits the peddle, speeding off down the track as he checks his built in GPS for the shortest route to the checkpoint.
Rankiryu grins eagerly before pointing towards the horizon, "CHARGE!!!"
The students, reluctantly, complied with the order and stampedes through the starting track, leaving dusts in their wake. For a bunch of muscle bound students, they sure can run fast.
-
'Anarchy' noticing that most everybody had effortlessly surpassed him, revved his Jetskates more, gaining speed (Going at least 60mph by now.), this was becoming dangerous however, as the turning on the Jetskates wasn't fine tuned just yet, and if he crashed into something, armor be damned, he would be severely injured.
Noticing a small detour that was out of the way, Anarchy made a large right turn into said detour, going what seemed to be a smoother part of the road with a small ramp at the end he could use to gain a hefty acceleration boost.
Also, before he forgets, 'Anarchy' quickly attaches the badge to his cloak.
ANARCHY ARCHIVES #2: Dimensional Travel
'January 5th, 2010'
"After that time travel incident I got to thinking, what if I could make portals, but instead of traveling through time, through dimensions instead? That is why I have made the Prototype Dimensional Jumper Drive Module XR-40. Or Jump Drive for those non tech-savvy people. It allows me to access (and more than likely cause) dimensional rifts. At first the prototype will only be able to access "Gates" which are, essentially, objects in this world that are the same in appearance and location in our world. I plan on exploring these heavily once I get a chance... The next upgrade will allow me to instantly jump from this universe to any universe I've been to previously using the prototype. Once I get the thing finalized I'll make mass-produced versions for the people I meet along the way so they can come and visit me. That way I'll at least have some friends who aren't that fake... Thinking about "it" makes me cringe.
-
The race started and the competitors have set off. Our heroes now speed through the familiar city of RPM, had been slightly altered for this race the race. Ramps, blockades and some minor traps have been set through out the track, as well the aforementioned hidden walls placed in specific areas of the tracks.
The racers must thread carefully, for what might seem like a shortcut, may be a clever and cheap trick wall, courtesy of Mr.Hatter's work crew.
As he heard loud voice of the announcer, ST blasted off on his vehicle, following Cap'n Blackhook's ship. ST was being followed by the hairy yet elegant shades wearing man on his styling magenta sports car. The strange lightning headed kid on the motorcycle, was slightly behind the duo of Clockston and Nightmare Sally, who were next the crimson, victorian era inspired autpomobile riden by the opera masked man simply named, General Crimson.
Falling behind are Nekolyan, who is struggling to catch up with the others on his rusted bicycle. Passing him by at a slow and steady pace is Brocky Bulldawg, who's making car noises as he rides his cardboard box. Passing them by is the man in the coffin, Hermescus of the Owleye House.
Meanwhile, still on the starting line are the homeless man, Franken, and the cloaked woman who pasted the fliers and posters for this race. The two bid their time until they felt it was time to catch up with the other competitors..
-
Anarchy Revved the Jetskates to their regular max speed (80 mph) and flew off the ramp, gaining speed as he was returning to the crowd, while he was in the air he noticed a small glowing object and grabbed it, then somersaulted into a perfect landing to allow him to not lose any speed or momentum, due to the ramp giving him an added boost, his speed was clocking at 87 mph. Getting him into a comfortable 2nd place.
ANARCHY ARCHIVES #3: The Preperation for Impending Doom (Part 1)
'2009'
The world is slowly falling apart, and I fear me and Kallen won't be able to survive, my willpower should allow me to come back to life (More on this later.) after this ends (IF it ends.), But I fear that Kallen won't be able to live if she is killed, hence I have created a perfect clone of her to wake up when the original dies. However, I still need to duplicate the emotional centers of the brain before she can be considered "Perfect". If she does wake, however, she will not remember dying (obviously), She will know everything the original knew, in a way she would be the original in both mind and personality. Nobody would know that the Clone was not the original Kallen, nobody except for me that is. A man could go crazy thinking about this.
Posted on: March 01, 2011, 06:11:17 PM
[Since I don't want this topic to fade underneath RPMvania (Which I thought was ending soon but whatever.) I'll just post another Anarchy Archive. ;)]
ANARCHY ARCHIVE #4: The Preperation for Impending Doom (Part 2)
On the topic of life and death. I have come to understand after my previous death, that death is very cheap. Willpower has the ability to bring people back from the grave. However, I feel that there are very specific conditions to how you come back, thankfully not all of them need to be met.
1). Somebody nearby must care for you deeply.
2). You've been near a large source of energy recently.
3). God Modding.
4). You've been a major player in a battle, or have been defeated rather painfully.
5). Kiss of Revival.
6). Coming back to life in an enhanced form. (As in, when you come back you are stronger than you were originally.)
7). Ass Pulling (Most Common)
One thing I have noticed however, is that only people who have traveled through time can come back to life, hence why people like Myself and Flame are able to revive after either death or complete destruction. But Kallen, having been here and not with me when I traveled, if killed, will stay dead. This applies to all who haven't traveled through the Space-Time continuum. I don't know about Dimensional travel though.
-
In the basement of the Mayoral Home of Daten City..
Corset: Ehehehkeee?! You failed me again, that plan was a total waste from the start!
Scanty: Bu-bu-
Kneesocks: Even though Scanty might be in shock, I'll explain.. Since those toilet-cleaning angels of the heavens managed to get through this so-called "gates", portals with enough access to the entire multiverse and conquer them all; But apparently those with evil energies cannot pass through. Scanty decided to clone a mad scientist and released a swarm of ghosts while the gates were still open, but now.. it's closed, and they might be defeated.
Corset: Kneesocks, you were always the one with the brains.. I'll see to it by the end of stardate 4.220 (or earlier), we'll make a portal, EXCLUSIVELY for us evil-doers! Hahaha... hahhaahahahahaahkekekekekekeekkekekekekekekke!!!
And this begins a new dilemma, will the Sparkvanians and RPM goers seek truce to combat this threat.. or will the entire multiverse be held in the grip of iornfisted rules of evil..? It's only a matter of time.. For now, let's get back to the race!!
-
[Ok, something I would like to know is, even though ST said no attacking of the other racers, I feel that story-wise the Sparkvernians would do it anyway, is that rule just mentioned and not really followed up on or what?]
[Also Gaia, thanks for holding the RP up a little bit, but lets try to avoid going 100% Panty and Stocking or this place will end up like RPM Fortress... Oh god, I'd hate for that to happen, Mainly because that was mostly my fault.]
-
[It IS allowed to attack the racers, as long as they are in their vehicles :D Also, if you are running on your own, that makes YOU the vehicle ergo, you are the target...and one of my character already started bombing other competitors >.>]
The Turbo X540 tank transformer continued firing rockets around itself.
A. Silan was targeted by a few of these rockets, but managed to dodge, even though she lost a bit speed.
Blackhook managed to change the direction of incomming missiles, which then targetted some unnamed sparkvenians, demolishing their cars.
"Not my style but in the name of justice, everything is allowed"
Sachertorte the bounty hunter and his horse Pfeferkuchen caught up with 'Anarchy'
"I like your guts, but with guts alone you won't win this race!"
He then pointed his machine gun arm at 'Anarchy'
-
"Anarchy" caught sight of the bounty hunter.
You think that pitiful machine gun can penetrate my Armor?
"Anarchy" Spun around flawlessly on his Jetskates, Pulled out the Powered Buster, and fired 3 shots at the bounty hunter.
-
" I can aske the same question"
Sachertorte's machinegun turned into an energyblade. He used it to effortlessly slice trough the blasts. Ha and Pfeferkuchen then jumped high, Sachertorte tried to impale 'Anarchy' with the blade.
-
"Anarchy" looked behind him, he noticed a ramp. He sped up to get some air off the ramp. He flew high up, but didn't fall, he had become sustained by the wind. He pulled out the Katana that Stocking had gave him, the blade shone brilliantly, it was a very high caliber piece of equipment. He turned to the bounty hunter, his eyes appearing to glow white.
Silent...Death....
His aim steadied.
ANARCHIST'S SLICE!
He flew at the Bounty hunter until he became close, then swiped, the blade had become supercharged by the speed of "Anarchy's" Dash, allowing it to cut effortlessly.
-
'Anarchy' then noticed something - The bounty hunter was no longer sitting on his horse.
"Come on, proceed your attack! I dare you!"
-
Anarchy froze, should he kill the man and get eliminated or kill the horse and be disgusted with himself?
Touche...
"Anarchy" sped up again, leaving a smoke bomb in his hasty retreat. He sheathed the Katana, hoping to not use it again as people pretty much knew the secret ability of it. He noticed a wall coming up, seeing as he had brought the Drill Arm with him, He equipped it.
DRILL!
Anarchy tore through the wall and made a small shortcut for himself (read: person sized), he then sped along and took 1st place.
[I'm assuming for all intents and purposes you want Sachertorte to not get killed in the first segment. Or at all for that matter?]
-
[well, I try not to get anyone killed...]
Sachertorte laughed.
"We found an interesting targed Pfeferkuchen, let's go, I wanna see if he gets trough round 1"
The two the took another direction than 'Anarchy'.
Troll Rex was tearring trough cars with his bare hands. He was carrying waddle dee, who cheered him up and showed him were to run. The other Otokojuku students followed them...
Blackhook used his wind manipulation to find a good shortcut, that wasn't protected by an invisible wall.
Back at the start Silan looked at Mr. Hatter
"Mr Hatter there is one question though, how can you even grant the prize?"
-
"Anarchy" Kept speeding up, going beyond the original limit of the Jetskates' Speed (which was around 60 mph) to around 99 mph, Trying to avoid going to 120mph, because that is where the skates will either burn out or blow up. In order to keep a measurement on his speed he has a small spedometer in his Red Eye.
Holding the first Token in hand, "Anarchy" came to the first checkpoint. Using the time advantage he had he restocked his weapons, and teaked his Jetskates a small bit, allowing them to go up to 140mph. In turn allowing him to move faster.
With the tweaks done he revved up the skates and kept going, eying the finish line which was about 50 miles away.
I'm going to win this. I have to, In order to beat the odds of the world I must win!
-
*slam slam slam pound pound pound pound*
Corset on Speaker: DAMN IT, THAT PART GOES THERE, NOT OVER THERE! ARE YOU EVEN USING THE THING BETWEEN YOUR EARS CALLED "BRAINS"?!
*scratch* *scratch*
Meanwhile, on the seats..
Gaia: *turns his head towards Shinji Ikari* Heh, that's Anarchy for ya~
-
Suddenly Blackhook's and Anarchy's paths crossed. The captain smiled. It was useless to say anything now, since both of them were too fast for proper communication. BH was impressed that Anarchy managed to built up this much speed, but that was still no match for the speed he could produce. The sails of his ship were durable enough to hold against even the strongest tornado.
The captain pointed both hands at the sail, creating a small tornado which was strong enough to propel the ship forward and take first place...only a few miles before they'll reach the first finish.
-
"Anarchy" Gathered speed, his speed matches Blackhook's. He simply decided to match the speed and cross the finish line at the same time. Since they were both on the same side why bother passing him?
3...
2....
1......
FINISH....
Thats what would happen if the thing was that close...
The Two continued down the path to the finish.
-
[Hmm, I should check up on this thread more often. I know this is the first of nine races but it ended rather quickly don't you think guys? Mind milking it just a little bit more before reaching the finish line? Btw, nice scene with Anarchy and Sachertorte, quick thinking Blackhook. Also for the next race, I must make a map of the future tracks.]
ST was falling behind Cap'n Blackhook, Anarchy and the bounty hunter Sachertorte. From behind of him, one of the tank's missiles was closing in.
"AHG! Hey, nobody makes the first fireworks of the race except for moi!" ST exclaimed.
Shaping on of his capes into a small rocket launcher with a smiling missile. He aimed it at the destructive armored vehicle. Of course knowing the strange mans way of thinking, he instead aimed his weapon up into the sky and shot the missile. When it quickly reached a great height, it made spectacularly colorful explosion.
"Beat that, Tank Man!" St shouted gleefully as he sped up. Of course, ST forgot that what he shot was still one of his weapons. The colorful sparks which began to rain down the racers were actually small bombs which immediately exploded once they made contact with any physical object. Most of the racers who made contact with this sparks were blown of from the race track.
The main racers managed to evade the bombs and catch up with the lead competitors. However some racers were having more trouble dodging the explosives than others.
"DAMN IT ST, YOU'RE JUST HELPING THE TANK!!" Nekolyan shouted angrily.
"Huh, looks like ST is also competing in this race as well...how quaint" Clockston told Sally, already used to STs antics.
"Looks like it...I wonder if Mr.Pirate is with him?" She said, hoping to meet again with her old friend.
"He hasn't changed a bit has he...how joyful." Crimson muttered, in a mildly annoyed tone.
Behind everyone, Brocky was still 'driving' at his own leisure, without a car in the world.
Back in the starting line, the homeless man was stretching a bit as the cloaked woman watched him.
"Well, that should be enough warming up."
The man grabbed tightly unto his kart, lifting one foot unto the bottom plate of the carrier, and raising his other foot up high. He strengthened his leg muscles and gave the ground a tremendously powerful kick, which sent him off zooming past the competition, closing in on the lead racers. After seeing the man leave, the shrouded maiden decided that it was her time to start racing as well.
From below her cloth sprouted four doll like limbs with all terrain wheels attached to them. As she bent and positioned herself, snaps and cranking noises could be heard from her body. She quickly set off, and though not as fast as Hobo Frank, she was making her way through the competitors, making sure to evade the attacks and explosives from the warring racers.
------------------------------------------------------------------------------------------------------------------------------------------------------------
"Hmmm, NOW you ask how a man as lovable as myself can grant such a grand prize as a whole, entire kingdom, princess?" Mr.Hatter said cheepishly, almost as if he was mocking her.
"Well as I have told everyone already, the leaders of this country are missing, so any man or woman with enough power could easily swoop in and take over this country. Of course, even if they we're missing, it seemed that the military and it's general, Flame, were still in this land."
As Mr.Hatter continues to explain to Silan just how he can give anyone a country he himself doesn't own, he calls to one of his crew members to bring him and the empress some wine.
"Care for a drink before I give you the finer details, princess?" The man offered.
-
[Alright, I'll milk it a bit. I changed my post of finishing to eliminate the discontinuity.]
"Anarchy" equipped Splash Mines, Fearing that fellow RPM-ians would get blown up by the bombs, he decided to paint them all RED. Why? Because Red is kinda the Color of Sparkvernia, so it should only blow them up, Right?
He scattered a few on the track behind him, He continued to speed up, as he was now clocking 130mph. He would need to get to the end of this race quick so he could modify the abilities of the Skates more.
"Anarchy" also noticed a hobo, not wanting the fate of RPM in the hands of a man who has only known how to ask for change and take stuff, he mercifully pointed his Powered buster at him and shot a volley off. Sadistic look on his face and all.
-
(Are we allowed to post vids, as long as it's a themesong?)
Scanty: We are about... 40% sir, given the speedup process and the increase in recruits. Without the damn angels, we pretty much have this town to our every whim once again.
Kneesocks: As a bounus.. we already have known about the Hellsmonkey gate key's whereabouts, so he'll be easy to capture. We will then send the Hellsmonkey through the gate; and let it cause chaos, that not even every god of the known multiverse will know how to control it.
*Guards push Breif in*
Brief: ...*eep*
Scanty: Already..? That wasn't very challenging, I WANT TO HUMILIATE THOSE FUCKKIN' ANGELS AND SHOW HOW WORTHLESS THOSE HORSECRAP ARE!!
Kneesocks: ..Calm down, please. We do not need the Hellsmonkey yet.
Corset *via speaker*: GGEEEET BAAAACK TOOOOOOO WOOOOOOOOORRRRKK!!
Both: YES SIR! *whoooosh!*
-
*Back at the Stadium*
Panty Eyed the Mysterious Spike Speigel.
Hello there, Mr. Space Cowboy. >U<
Do you need something?
Comeon, you're a total stud. Lets go see if you have the strength to match the looks.
He isn't intrested.
SHUT UP! So anyway... Huh? Where did he go? o-O
-
[@Gaia: I think it's best to only post a link to the thread. Course I'm not so sure about the rules of RPs and adding videos in the threads if said RPs.]
Fearing for his fellow RPMians, Anarchy threw an explosive to the racers with splattered them with a scarlet color. Not knowing that ST explosives were not homing type weapons and were merely exploding wherever they landed instead of following the color types of the racers. As to how this would effect the living weapon, Turbo X540, targeting system is yet unknown. However, instead of helping his fellow citizens, the splash mines had only caused confusion and mild chaos.
"GAAAH, MY EYES! THEY CAN ONLY SEE RED!" Shouted a random reploid on a hovercycle, as he quickly crashed with some other competitors who were driving a little too close to him. said racers also crashed with the other competitors who were behind them. (-13 racers)
"EEEK! MY SHIRT! IT CLASHES WITH MY SKIRT! I DON'T DESERVE TO BE SEEN IN THIS CLOTHES!!" Exclaimed a drag queen who was devastated by the sudden sabotage of his garb. He tried to turn back, only to crash against some more racers. (-25 racers)
"MY SANDVICH! IT IS COLOR OF ENEMY!!: Said a loud and large blue man, who proceeded to lament over his lunch as he ran over some other competitors. (-52 racers)
"AAAHHHGG! UNWANTED COLORSCHEME! UNWANTED COLOR SCHEME!" ST shouted hysterically as he soon began to loose control of his vehicle and squashed a few racers along the way. (-74 racers)
"HEY, WATCH THE PAINT JOB, YOU ASS!" Screamed Bishounen Caveman at Anarchy, since some of the red paint was splattered on his sleek automobile, speeding up to reach to Anarchy and give him a welcoming fist to the face. this of course caused him to push aside a few racers on his rampage. (-85 racers)
"...I am unaffected by this." Crimson said quietly, mostly to himself.
"...We should steer clear of that man in the cloak and armored skates, Sally" Clockston told his adopted granddaughter.
"NYYYAAAAR!! I'M RED NOW! THIS, THIS...this...doesn't look so bad on me...heh. I might keep this color for my armor." Nekolyan said, a bit happy to have been completely painted on.
Brocky was eating the paint, still moving at a snails pace.
The one of the first to be splattered by the splash mines, Frank was unaffected by the 'attack' and merely wiped of the paint from his face. As he quickly caught up to the lead racers, the man hopped both of his feet unto his shopping kart. He maneuvered the carrier very precisely, making sure to evade most of the buster shots from Anarchy's volley, while throwing some random trash from his kart to stop the shots that were in his way.
The hobo started drawing closer and closer to Anarchy and Blackhook.
-
[Oh wow, Thats [tornado fang]ing hilarious. I didn't know GBD and Blu Heavy were hiding around.]
"Anarchy", not knowing the outcome of his splash mines would be this disastrous. Sped up to avoid any anger.
However, a rather odd Caveman came up to him bitching and moaning about the paintjob.
You have a problem with the paint? Well, how's about a drill to your engine?
Anarchy quickly pulled out the Drill Arm and proceeded to penetrate the car's chassi's and completely wreck the motor. Putting the caveman out of business.
Seeing as the hobo is catching up and heaving trash, "Anarchy" decided to be nasty.
You! Trash guy! Present for ya!
"Anarchy" slowed himself down enough to slap a few splash mines onto the Hobo's cart, then quickly sped back up to his original speed.
[So whats the Deal with Brocky Bulldawg? He seems to be the comical clown.]
-
[@Anarchy:That's pretty much how I wrote/made Brocky Bulldawg. Though be weary when he actually gets serious. Of course if I ever get to start the story he is in, he might act a bit more seriously in that universe than in this one. RPMs Brocky is mostly for comical purposes.]
Bishounen Caveman was furious at the sudden sabotage of his vehicle.
"YOU ASSF@*#! My layer will hear of this!" He angrily shouted at the destructive half cloaked man. Not wanting to loose this race, the caveman had no choice but to rely on cartoon antics to save him. So using his caveman strength, he kicked a large hole on the base of his care and as quickly as he could to move his car. This of course ruined his once clean and shiny designer shoes.
"Damn it, I spent 2100 zenny on this shoes today, and you forced me to ruin them! I'LL GET YOU FOR THIS, CLOAKED BLUE BOY!!" BC was slowly loosing his pace as the other racers went past him.
Garm Dasce found an alternate route through an old parking lot. Curious of this path, a small handful of racers who were falling behind followed his lead. This includes Nekolyan, the cloaked woman, and a bit later, Brocky, who seemed to be sight seeing rather than focusing on the race. He even went so far as to take some pictures along the way.
"More paint bombs, kid? That seems a bit disapointing." Hobo Frank told Anarchy right before he left.
The man hopped unto his cart and spun himself and his 'vehicle' at great speed. Though not strong enough to loosen the mines, it was good enough to splatter the paint of the recently ignited explosives at the nearby competition.
The man stopped spinning and went back to his driving position. Of course the stunt he pooled slowed him down a bit, securing at least 5th place in the race.
Only a few miles before the racers reach the first finish line. Blackhook and Anarchy in the lead, followed by Sachertorte, who was being chased by the frantic ST. Followed by Hobo Frank and some other nameless racers, most of which crashed thanks to more of Anarchy's splash mines (-92 racers)
-
Turbo X540 dashed with incedible speed and eventually caught up with ST.
"Biological lifeform, I accept you challenge. Noone makes better fireworks than I"
The transformer pointed his large weapon to the heaven and fired one shot. When the shot exploded in the sky it created a rather flashy flower pattern. Many contestans looked up, but then they realized in horror that every piece of said pattern was an energy shot and all those shots were now raining down, hitting several cars (- 80)
Sachertorte avoided one of those bullets.
"Idiot, who know he would take something like that serious..."
Adante followed by the Spark 5 didn't try anything to get rid of the competition. After all, this was just round 1, it wouldn't be fun later on.
Blackhook was still sharing first place with 'Anarchy'. The pirate captain created an even stronger gust of wind, though he had to be careful not to destroy the ship or anything around him...
"I never drink wine...besides I don't feel like putting down my scarf."
Replied the ruler of Sparkvenia.
"I just hope that you really have that kind of power, otherwise if you wouldn't be able to fullfill your promise and give the winner the deserved prize, you know what would happen to you?"
She said that with a cold, threatening look in her eyes.
-
[ST wasn't sharing first place with you, I was. :(]
"Anarchy" continued to speed up... He had to make sure he was in 1st place... With the Power of RPM in his hands he knew he could do good.
He waited behind the large vehicles in front of him, Slowly gaining speed by drifting.
Then, once his speed reached 135mph, He jetted out back into the lead... With only a few seconds before the end of the race.
-
[I know..it was just a typo :D]
-
*crash boom BANG!*
Kneesocks: S-Scanty.. it's.. beautiful..
Scanty: .. No words..
Corset *via speaker*: *ahem* Now that the portal is finished somehow rather quickly, which would take decades to make, let's send in the first ghost in as a test subject.
The ghost walks in, only to be followed by a rather large explosion.
Fastener: faaaaa... *head droops down in failure*
-
[I know..it was just a typo :D]
[K :)]
"Anarchy" had gotten 1st place. Just inches infront of him was the Finish line. He quickly crosses the line, amazed at winning the first race.
The crowd cheered:
ANARCHY! ANARCHY! ANARCHY!
1st: "Anarchy" 250 Points + 1st Race Token= 750 Points.
-
[I thought we would be sharing first place ;_;]
BH came in second.
"Huh? When did he get past me? On simple jet skates? oh well, I'll do better next time.."
He recieved points for second place and for finding a token aswell.
Adante got Third, he didn't find a token, sadly...
-
[I thought we would be sharing first place ;_;]
BH came in second.
"Huh? When did he get past me? On simple jet skates? oh well, I'll do better next time.."
He recieved points for second place and for finding a token aswell.
Adante got Third, he didn't find a token, sadly...
[sorry, kinda got confused earlier with the Typo. Oh well, 650 points isn't bad. It'll make it close between "Anarchy" and Blackhook, besides, if either of them win its Good for RPM. :P]
-
[I should raise the number of racers in this arc, in case more random chaos like this ensues in later episodes. So this competition here by had a total of 1000 racers. Now it has 828 racers. (-92 from the domino effect of Anarchy's splash mines, and -80 from Turbo X540's fireworks display.]
"I see. Okay, princess, if that's what you want, more for me!" Mr.Hatter took both glasses of wine gulped their contents in one gulp.
"MmmHmmmm. Yummy." He said in satisfaction. He then turned to face Silan, with a wide grin on his face.
"So, I take it you DON'T wish to know the details as to how I can grant such a wish. That's okay, it's none of your business anyway." He said, in a melancholic tone.
"Hmmm, from the noise from the crowd it seems we already have a winner! Well I better go congratulate them! Talk to you soon, Princess~!" Mr.Hatter then left the tent to go to a recording room, where he will communicate with the racers via one of his Lakitu.
-
Scanty: Sis, I think this time we got it, send in a test victim.
*the victim walks in, and again it explodes as soon as it enters*
Scanty: AAAGGHHH!! This is so annoying! That's the second time we tried this, and it's not working! Perhaps.. It might be the energy source..
Kneesocks: Yes.. but where are we gonna find the energy needed.. *snaps fingers* Aha! I know!
Scanty: You mean...?
Kneesocks: The desire for travel in human souls. Since the desire for travel is limitless we can pretty much use this as an energy source!
Scanty: Kneesocks, you are a smart one..
Corset *via speaker*: Now that you two have figured it out.. GO FIX THIS PROBLEM!
*woosh*
-
[Alright ST, remember how you said there was an objective in the races that we get points for clearing? Can you explain what those are at the beginning of the races? Also, are there more than one token per race? I'd say two is fair since me and Blackhook both got one.]
"Anarchy" noticed the Lakitu.
Yes, thats right. I did win the first race, I'd like to thank my fans for supporting me, and I'd like to thank Blackhook for closing out second place to RPM. It doesn't really matter who wins Unless its Sparkvernia., but a win for RPM is a win for More peace! Also, I'd like to give a shout out to Stocking! I'll see you when this race is over!
-
"Hey crew, your good ol Cap scorred second! Don't worry though, this competition is the greatest fun I had, and it only started! SO I hope everyone gives their best!"
Said BH to the Lakitu. His crew cheered on the ship.
Adante the third placed also said some words
"I don't feel sad because miii Sparkvenia didn't score first. The race has miiii only begun. And as long as miii I am racing, there is no way for us to lose!"
Silan got annoyed by Hatter.
" I swear, I'll kill him after this race..."
"Oh Sil, don't say such things"
Replied Temnota trough a comunicator
"BTW Sil, you see who got second?"
Silan looked at the monitor.
"..how interesting"
-
*tap tap tap whiiirr pound pound pound etc etc*
Kneesocks: Nii-San, would you be a kind dear and stick your head into the portal?
*PINCH!*
Scanty: Looks like it works now, but I have a crab on my nose. Just needs calibration, try looking for those two angels and see if they appear in the portal!
And so, the new threat slowly but surely looms over RPM. The Villan's Takeover is imminent..
-
[You probably should hold off on that till we get some more races done.]
-
(Yeah, but controlling just Gaia gets boring from time to time, and unlike this one, the last Busy World I didin't get much of a chance to participate in everything that's going on all at once, sooo.. yeah)
*Gaia walks up to Anarchy*
Gaia: Good show, intresting trick you had there. I didin't think I was going to have that much of a lightshow anyway, considering the race's rules and all.
-
[Y'know what, I'm done using Quotes around Anarchy all the time.]
Y'know, I didn't mean for that craziness to occur. But I did let my anarchistic side out by drilling through that idiot caveman's engine. :D
Anarchy looked around, he saw Stocking hovering around the area.
Stocking!
Hey! great job getting first!
I couldn't have done it without your help, you know, with the good luck and all.
Well, you still have 8 more races to win. Give them hell, ok?
Stocking then pulled Anarchy closer and gave him a small kiss on the cheek, then she ran off to the See-through, where Panty was waiting.
Have fun with your Boyfriend?
Stocking Blushed a small bit.
He isn't my boyfriend! Shut up!
You don't need to hide this kind of stuff from me, Sis. ;)
Anarchy stood there, feeling his cheek while the two drove away.
Its... been a while since... anything like that has happened...
He then waited with the other racers who already finished, the happiness in his face gone. He then muttered under his breath.
I can't have anything happen to her, I don't need to see more people I care for hurt... I need to protect Stocking at all costs... I might've made a few enemies for all I know, they could target her, if I lose her than what do I have anymore? I feared them showing up for this very reason! No matter, I have to keep my mind on the race.
Anarchy then turned to Gaia.
Hey, if you don't mind, could you keep an eye on Stocking? Make sure she isn't in trouble or anything? I don't want anything to happen to her.
-
[Sorry to break it to you guys, but there's only one token for each track...and they aren't supposed to be so easy to find either.
And to make things more interesting, each track shall have a special challange
which counts as 250 extra points to the total score of whicever racer(s) can accomplish it.
Not only that but there is a special token in each track that are worth a whopping 500 points!
Of course, the token won't be easy to find easy to find, but keep an eye out for 'em
'cause trust me, they'll be worth the trouble!
Though really, it's mostly my fault for not laying down the landscape for this track and it's special bonuses (which by the way are things that multiple racers can do. It's a good way to raise your ranking in this event.)
However, I have a way to fix this, which might be good for those who have yet to finish the race. (aka' White-Jet and Afroshroom.)
Also, here is the chart for the points of the race:
Now then, this race runs on a points system.
Racers shall receive points depending on the order the racers have passed the finish line.
1st place gets you 250 points.
2nd place 150
3rd place 75
4th place 50
5th place 25
all others shall get 24-0 points in the order of their arrival.
Anyhoo back to the RP.]
A lakitu holding a large, flat screen T.V. came towards the winning racers.
"CONGRATULATIONS ON YOUR VICTORYYY, MR. ANARCHY!! I hope you're having as much fun in the race as our viewers are watching it. I would have asked if you had any words to share with the audience, but it seems you already have. How incredibly cock-humble of you!
And I see you got a token in your hands! SPLEEENDIIIID!!..." Mr.Hatter shouted cheerfully.
"...Hmm, but it seems that the pirate over there from what my lakitus see also has a token in his hands. Hmmm, I could have sworn I have said there was just one token in each track." He told Anarchy, still giving off a cheerful tone.
"Oh well, I'll explain it later once the rest of the racers have arrived."
After Adante's arrival. Sachertorte came in scoring 4th in the race, followed by the strong Hobo Frank in 5th.
ST was still a bit shook up from having his color scheme changed, but he managed to get into 6th place. After him were Random Guy 1 and Random guy 2, who were followed by Mr.Potato Head.
Slowly making his way here, was B.C. (Bishounen Caveman), who seemed rather ticked off by something.
[The rest shall be mentioned in my next post in this thread. Hope White-Jet and Afroshroom post soon. Their characters might not even get into the 24-0 scores.]
-
[My token was kinda up high in the sky. Not to mention out of the way. Lets just say there was an accident and they dropped two tokens on this track instead of just one. Also, I love how Hatter changes words up, almost calling me cocky to switching to humble instantly.]
-
[Yeah I can understand that, but I still think that may have been too easy, already came up with something for this anyway, hence why I said that this might give other RPers a chance to score higher in the ranks.
I aim to make loveable and/or unique characters.
And to not make myself a liar...]
10 more competitors passed, most of them composed of regular but brave civilians from both the RPM and Sparvanina racers. One notable was a competitor named Cruiser. Who seemed like your everyday kart racer, but bared an emblem of a star being pierced by an arrow on the forehead area of his helmet.
After reaching their destination, the racers got off from their vehicles and began to stretch their muscles.
-------------------------------------------------------------------------------------------------------
Meanwhile, Insed the abondonned parking lot, some of the racers seemed to have lost themselves in the building, others crashed unto the many pillars. (-25 racers) It also didn't help that there were some invisible inbetween some of this pillars, which raised the numbers of fallen players. (-64) However, Garm Dasce was doing quite well in evading the pillars and invisible walls. It also seemed like he to knew where he was going. Perhaps he had traversed this parts before. Though rather than using this place as a shortcut, he seemed to be on the look out for something.
The cloaked woman wasn't quickly passed the motorcycle rider as he was distracted searching for something. She soon found herself in the exit, nearing the finish line. Half-way through the lot, Nekolyan was threading carefully, making sure not to sudden;y hit one of the invisible walls, while trying to maintain a decent speed in the race.
Falling behind, but not dead last, was Brocky Bulldawg. Who was sniffing around the parking lot, moving at a slow and steady pace. Like Garm, he too seemed to be looking for something.
-
[Right-O, its your Story, we're just the Characters. Continue as you wish. :)]
Anarchy was busy modifying the Jetskates...
This goes here... A little more to the left... Insert this to complete the circuit... Done!
The Jetskates have been modified into the Jetskates DX, Capable of speeds up to 220mph, with added shock buffer to dampen damage to user by 60%. Control has been improved as well, allowing them to turn easier when going at those higher speeds.
[We can upgrade our vehicles to make them more powerful in the upcoming races, right? Technically that doesn't mean a switch in the vehicle, Just making them stronger and more versatile. (As in, I don't upgrade from Jetskates to a literal jet.)]
-
(Well, I asked RMZX about this RP, he said just to jump in. Hope you guys can run me from here, because I have no idea what's going on as of now. Excuse any mistakes I make, et cetera, and here goes nothing. *Sigh* Will be short, since I'm a bit burned today.)
Zero coughs a bit as he walks through the city. Kind of dusty here. He mutters to himself as he stretches out his arms. Glancing around to his sides, he continues walking foward aimlessly, looking for any kind of adventure or event or anything that is remotely entertaining.
(P.S. Yeah, it's obvious that I'm nervous. Kind of edgy since... My last time RPing with you all. Well, anything needs changing, I'll be glad to do so.)
-
[@Anarchy:Modifications are allowed, in fact, they're encouraged in the later races. As long as you don't switch, steal, and/or create a new vehicle, you can modify your vehicle as much as you like.
As long as it's slightly and the modifications are done in between each race/checkpoint.
@ZC: We're having a race. Right now most of the audience who are watching this race are near the entrance to the God Killing Complex Ruins. Located in the southeastern gate of the city. Though it seems that we might soon get an unwelcome visit from a few ghosts.
And I'll update the story later, I still feel a bit tired.]
-
[Well, that works for me. I plan on having 4 more modifications. This current version is more of a speed/armor enhancement, the next one I'll focus on Acceleration and Turning, the one after that, Special abilities, my Final enhancement will be an all-around upgrade that improves all the stats and makes the Jetskates very, very, valuable.
-
Meanwhile back in the middle of a cluster of remaining random racers...
Agent J:
"..." She was quickly swerving past several crashed racers and soon passed the finish line. She was disappointed about not getting there soon er but at least she was able to finish and keep an eye on- "?" She looked around, it seemed she passed Afro-Man and A.Silan by accident in the heat of all the previous event. She got out of her vehicle and furiously stomped the ground at her mistake.
Afro-Man:
After quickly punching a piece of the missle from the tank which ST exploded, back and having that fragment explode into a group of random npc racers her looked past his shoulder,"Damn...looks like I lost track of my Alternate self here...well I suppose if he's like me he should be fine...I think." he said as he finaly got to the finish line but was on the other side of the group from where J was.
Waddle Dee:
Guided Troll Rex towards the finish line after batting back a large boulder tossed at them by an npc who was riding in a large catapult for no reason other then to throw rocls and random racers. "..." He 'shouted' pointing eagerly at the finish line, quickly ducking as troll rex tossed a car over his head that was in there way. Looks like his attendacne at the school was coming in handy now.
Afro:
Afro some how drove into an time and space worm hole that allowed him access to any where in the known multiverse! ... So he decided to go to the drive through and after a snack returned back across thefinish line! "Yes I..." He looks around being dead last, in points any how, and got a measly point. "...well at least I still got you happy meal toy." he said holding a cheap plastic toy which broke immediatly. "..." He curled into the fetal position and rolled next to his car and the group of other, more compitent racers.
(Man I need to log on more frequently. X_X; )
-
[I think its time for an Anarchy Archive. From now on these will be descriptions of RMZX "Anarchy"'s travels through dimensions, told in a more flashback type of writing compared to a Journal Entry like the first 4.]
ANARCHY ARCHIVE #5: Destinations Unknown.
2010
I freed myself of my past life, with people not noticing my dissapearance, I can safely travel through Dimensions.
RMZX typed some coordinates and a destination on a small handheld device: The Coordinates were simple, Date, Time (24-Hr), Location.
DATE: NOVEMBER 5
TIME: 12:00
LOCATION: DATEN CITY
RMZX then opened a portal, it was purplish and hazy. Looking closely enough you could slightly make out the location that was about to be entered.
He then walked through.
(TO BE CONTINUED IN ANARCHY ARCHIVE #6)
-
Gaia: Stocking.. pleease don't do anything rash, because right now Anarchy put me on Protocol Droid Duty. And my first task is to keep you safe, no matter what.
*elsewhere*
Scanty: 4,00032, 400035, 400048. That's all of them! Now, let's send our drone to watch the race, and find a perfect oppertunity to strike; hehehe..
*the drone enters the portal, and comes out at it's desired destination. It now is in camo mode, sheilding itself from any people-finding technology of all kinds, heaven and otherwise, from the naked eye. However, it can be sensed with Ki. To avoid capture, the drone lowers it's Ki levels to -9,000 so that not even the most knowlidgeable sage can detect it. It now watches the race from a bird's eye view..*
-
Anarchy continued to rack his mind.
"Stocking, after this race is over, whether I win or not, I'll take you to the fanciest sweet store in the area!"
This thing that he said continued to lurk around in his memories.
He thought to himself, what if after I win Stocking is gone? or if she vanishes before the race is over? He didn't want to see her hurt. Naturally, being the emotionally sensitive person underneath the tough exterior he made for himself, he fell into a depressive state.
-
To avoid capture, the drone lowers it's Ki levels to -9,000 so that not even the most knowlidgeable sage can detect it.
(Its UNDER 9000!~ *a scouter goes from being crushed to normal in his hand*)
Elsewhere in the audience stand, Cap'n Afro, Afromania and Agro (who still has had yet to get his hair cut again) watched and facepalmed at Afro's...'coping'.
-
Shortly after the arrival of Afroshroom, 50 racers passed the finish line, the in between these were Garm Dasce, who seemed to have put something inside his pockets, Hermescus, the Spakvanian 6, and the cloaked woman.
Back in the parking lot, Brocky was still sniffing around the track, Nekolyan was staring at his ally in confusion and stopped to ask just what he was doing.
"Brocky, I know we're probably already dead last, but, shouldn't you try to at least finish the race."
Brocky momentarily ceased his search and looked at his friend.
"...I will...after I find what I'm looking for." And he quickly went back to searching.
"...*sigh*Whatever, I'm gonna go finish this track and see if I can find something to make this ride suck less." Nekolyan said, a bit flustered.
[Where's White Jet?]
-
[Sorry, momentary writer's block]
While it seems as though Brocky and Nekolyan were dead last, they were far from the truth. As the racers came past the finish line, they failed to realize Tango hasn't woken up from his nap and completely missed his cue. Somewhere in the universe, Clef is facepalming in irritation.
Of the 50 racers that crossed the finish line, Ryuta and the First Year of Otokojuku were near the front, though Ryuta was slightly faster because of his custom ride chaser.
-
[Alright, bringing this back into relevance.]
Anarchy glanced about, seeing as the next race wasn't going to start for a while, he revved his skates and went back to the stands to converse with his friends. He took his sunglasses off and removed the Redeye. seeing as he didn't need them anymore as he was around people he knew.
Phew... I'm tired, anyway, race 2 isn't going to start for a while, so I figured I'd rather be here than with the racers I'm trying to beat. Besides, I pissed off some caveman by jamming a drill into his engine. Oh well.
The brightness in Anarchy's eyes faded, his eyes looked dull, almost dead. You could tell that something was troubling him. Stocking tried to console him.
Something wrong? You were pretty upbeat earlier, but now you seem.... depressed.
Sad you're still a virgin?
PANTY! Thats obviously not the issue here!
Yeah, Yeah. you think he hasn't thought of doing you?
Quiet, thats not what this is about.
Fine, but don't come crying to me when he starts coming onto you.
On another note, why do you have somebody watching over me? I can protect myself!
I don't want you to get hurt... if anything were to happen to you... I don't know what I'd do. I can't lose anybody else.
Anarchy then looked at stocking.
Stocking, I need you safe. I guess i'm a wuss like this. Having a bodyguard protect you.
You aren't a wuss. I'm glad you care about me.
[I still have to finish thi, I'll put up the rest of my post later.]
Posted on: March 18, 2011, 08:23:28 AM
[Alright, following up on my last post.]
Why are you glad I care for you? I must be kinda hideous.
What makes you say that?
Panty didn't try to seduce me, thats why. Thats a sign that she thinks I'm bleh. :\
Well, I think you're great. You're considerate, and you would do anything to help somebody you care for.
I guess... you're right... Oh, before I forget, I grabbed this during the race.
Anarchy pulled out a small box from within his coat, inside was a piece of cheesecake. Stocking smiled, and took the cake. Eating it slowly to be able to savor the sweet flavors.
I Love Cheesecake! Thanks, I didn't get you anything though...
Thats fine, I just wanted to get you a little something.
You didn't need to, but thanks.
Stocking gave Anarchy a hug, he responded by hugging her back, he started to feel comfortable. He had only felt like this once before, but that paled in comparison to his feelings now.
-
"Well, this sounds really interesting. Miii miii miiiiiii ♫"
Anarchy noticed only now that he was standing back to back with the musician Adante.
"I always wondered miii. What is the sound of a dying angel?Miiii"
-
*Gaia turned around and answered*
Gaia: You again? For that answer it's a sound of one thousand Yukkuris multiplied wailing at the intense heat of the sun. Try killing a Saichel and see what I mean.
-
Anarchy turned around.
Its you... what do you want... and what do you mean?
Anarchy looked at the strange musician, his sunglasses somehow back on his face.
Little did he know that every movement of his was being monitored by the hidden drone.
A sign of stress was noticable on Anarchy's face, Stocking stood behind him.
[oh, and don't be trying to kill stocking, ya hear?]
-
"Miii, miii miiiiiiii"
Suddenly anyone who was standing near Anarchy and Adante wasn't able to hear what the two were saying.
"That was an impressive victory, though I wonder miiiii how badly do you want to win?"
The musician looked deeply in Anarchy.
"It would be ...sad miii if something would happen to your friends miiii.Believe me, you wouldn't be able to do anything against it, except one thing. You understand what I'm getting at, don't you miiii?"
-
You telling me to forfeit? Never. I have to win this race, it'll be to atone for what I've done in the past, the people I lost, the people I've let down. If you think I'm going to forfeit....
Then go to hell.
Anarchy kept a straight face, unmoving in his facial expressions.
-
"Forfeit? What fun would that beeeeeee?"
Adante had a demonic expression on his face.
"You will continue on with the race, but as a citizen of Sparkvenia. You see, miii, I kind like you. The underdog who miii won the first part without an actual vehicle..."
He put on a fake smile.
"Take it as a friendlly offer miii, so please reconsider your answer."
-
Anarchy Froze, let his morals slide and join with them? Or tell them to [acid burst] off and lose his friends?
And what if I don't? What will you do then?
-
Adante pointed his finger at Anarchy and started singing
"♫Miiiii, miiiiii MIIIIIIIIIIIIIIIIIIII!♫"
(Adante has the power over sound and also he can affect one's sound perception. He can make your hearing so strong that any sound can basically kill you. Though here he just uses it to hurt Anarchy)
-
What are you... GAHHHH!!!
Anarchy covered his ears, hoping to eliminate the pain, it wasn't working... the sound became unbearable, he fell to his knees in pain.
AHH! I'll never join sparkvernia, you'll just have to kill me!
Anarchy fought to get himself back on his feet. His willpower wasn't to be broken that easily.
-
The pain stopped
"Idiot. I was just showing you what I will do to everyone dear to you.What do you have against Sparkvenia anyway?"
-
[And now I have guilt for not showing up sooner...is what I would say if this story had progressed drastically in my absence. Sorry for the wait guys, I had a bit of a writers block myself...and I may have shamefully spent most of my free time being addicted to something I never thought I'd play again for such a long time.]
The rest of the racers had passed the finish line, all except for Tango, who has been sleeping in the starting point this whole time. Since most racers have already finished the first race, the green cat has been disqualified due to not participating in the race. In between said racers was Garm Dasce, who seemed quite happy about something.
"Ah, finally everyone made it the the finish line! Well, most of everyone at least. Seems more than 200 racers were lost in this track. How path-pitif-SAD, very sad." Mr.Hatter said through his monitor, rather cheekily.
"Of course, it's nothing our Lakitus can't clean and pick-up. All fallen competitiors shall be taken to the nearest medical facilities, and the scraps of their vehicles shall be cleaned by our special Janitor Crew. But that's the least important thing right now. LET'S SEE THE WINNERS OF THE PROLOUGE OF THE RACE OF DESTINY!!...But first, has anyone gotten their hands on one of those special tokens I was talking about earlier? Those of you who have, please be kind enough to show us your bounty!"
-
Suddenly a figure emerged from Adante's shadow and grabbed the musician's shoulder. The sound around Anarchy and Adante returned to normal.
"Miii? Miss Temnota? Is something wrong? (When did she get inside my shadow?)"
Asked Adante
"His presence is needed."
The girl pointed at Anarchy.
"Mr. Hatter wants to see those who found the special tokkens...so whatever you were discussing has to wait."
Temnota looked over to Anarchy with a cheerful and warm smile.
Blackhook heard the message and went to show off his booty tokken.
-
What do I have against sparkvernia? Hmm, well the fact that you tried to blackmail me onto your side doesn't help your case. Why don't you tell me what is so great about Sparkvernia that you decide to live there? I'm dying to know.
Anarchy looked at the suspicious girl with a glare, he quickly went to Hatter and showed the Token. He then went back to the seating area with Stocking and the others.
-
Before Anarchy was able to go to sit down with the angelic vixens, he was stopped by a lakitu.
"I don't believe I said you could sit down, yet. Now pleeease, get your mish-nicely shaped buttocks back to the field and properly present your token."
Some of the contestants were muttering amongst themselves when they saw two tokens being held, knowing well enough that the announcer said there was only a single racing token per stage. After the two first have shown their bounty, Garm Dasce came out from the crowd and presented his token, two more competitors came up and presented theirs acordingly. One of whom was Brocky.
"So, five in total. Hmmm, I was hoping for some more to be found. Well then, 4 more tokens than what I mentioned. Do you people know what this means?...Anyone, anyone...nobody huh. Well, not to be a rude host but IT MEANS 3 OF YOU CHEATED!!" Hatter glard at the token holders
"...Just kidding. Truth is, all those tokens are the real thing. In fact, this track had 10 tokens hiding away, some were easy to find, the rest were not so easy to find apparently. Though like I said, there is supposed to be one token per track. Said token cost a whopping 500 points! That's twice the winning points for getting first place in the races." He informed the racers.
"However, I'm sorry to say that only one of this tokens is actually the 500 points winner, the others are duds...course for all we know, they could all be duds! Kyo HO HO HO!~" Hatter laughed whole heartedly
The Lakitu began inspecting the tokens to see which one was the held the bonus points.
[And now to throw a dice, pick a number between 2-6. 1 means nobody got the token.]
-
[Ah, nice workaround.]
Posted on: March 19, 2011, 07:52:03 PM
Anarchy looked at the stands, waiting and sort of pissed off.
Hmm... wheres Stocking? I see panty... but, oh [parasitic bomb].
Anarchy gave his medal to Hatter and ran off.
If mine was the winner let me know! I have something I need to do!
Anarchy made a mad dash for the stands, trying to avoid any sort of obstacles in his path to get to his destination quicker.
Panty! Where is Stocking?
Hm? She went to get snacks, I said I should come with but she insisted that she would be fine.
Thanks. Damnit, I should've got a [tornado fang]ing Concession booth attached to my stands. I'll catch you later.
He looked around the concession area.
It was empty, like everybody in the area had completely vanished from existance. He saw a small note attached to one of the stands.
IT had words on it, but Anarchy couldn't make them out... except for the occasional "Mii".
[tornado fang]ing [parasitic bomb]! That musician bastard was here!
He continued to look around... until he saw what looked like a random ribbon on a twig...
It was Stocking's hair bow... slightly ripped... on the corners... blood? It couldn't be... Stocking was hurt. Adante had something to do with it. Anarchy went pale with shock. If Stocking was dead then what good would trying to save her be?
[Sorry bout this, I just felt I needed to create some sort of dilemma.]
-
While waiting for the next race to start, Ryuta sits at the Dragon Truck, sipping on a can of chocolate soy milk. Hajime didn't charge for the drink since Ryuta is his superior, but in order to doop the eavesdroppers, they pretended to exchange the amount.
-
*feeback from the drone reveals some rather irratable images*
Scanty: Kneesocks, do we invade? I WANT TO RIP THIS "MII" GUY'S GUTS OUT, NOBODY KILLS THE ANGELS OF THE TOILET BUT US!
Kneesocks: Permission, Corset?
Corset: Ah fine whatever, just don't fail this time. If you do. *flushes toilet*
Scanty: ALRIGHT MY LITTLE GHOSTIES AND DARK ANGELS! (as seen in Neon Genesis Evangelion) LET THEM SHOW WHAT WE ARE MADE OF, IT'S A FULL-SCALE INVASION, GO GO GO!!
*then all the dark entities rush towards and into the rigged dimensional barrier that they have been trying to create for months. Then they follow*
Scanty: Alright, now we find this "Mii" guy, then we kill him. After that we hunt down and take out the angels once and for all!
*elsewhere*
Gaia: Stocking, STOoOoooooooooooccckkkiiinggg! Dammit, where the hell did she take off to? I might look around at the local consession stands to find her..
*sees what looks like a loli goth munching down on her food*
Gaia: AH! There you are. Better call Anarchy.. *calls through his specialized phone, which unecessarily contains everyone's phone number*
-
Meanwhile. Above the racing ground was flying the flying ship SIlan used to live in before becoming leader of Sparkvenia. Now the ship - The Edeleisen- was being used as a monitoring station for the 'Judges'. Temnota returned teleported back to the ship...though not alone.
"Miss Temnota...what have you done again?"
Asked Ritter Sieg.
"Just messing around with Adante and that death faking boy."
As she said that, something emerged from her shadow - the angel known as Stocking - who was happily munching on some sweets (bri...donation by MR. Hatter).
"I can't allow Adante to cause havock..I am not the type who can stand violence..."
-
Anarchy held onto the hairbow, the faint red stain on the light blue fabric made a slight purple-brown color that Anarchy couldn't possibly get out of his mind.
Stocking....no...please...don't be dead...
He fell to his knees. His arms shook in terror, he did not cry, the traumatic pain of losing somebody wasn't foreign to him. He had felt it before.
His phone rang... He looked at it, but did not answer.
Anarchy looked up, the sky... for some reason it was always so grey. Now it just looked empty.
-MEANWHILE-
Stocking stood on the ship, eating sweets.
Why am I here? Who are you people?
-
*ELSEWHERE*
Gaia: Goddamnit Anarchy this is important! Jesus man, do I have to hunt ya down myself?! *scurries towards Anarchy's location*
*MEANWHILE*
Ghosts, Dark Angels, Black Dragons, and other evil entities began wreaking havoc on the first area they've come across: Sparkervania; whilist the other remaining dangers charge into RPM territory. Of course, this angered "the protector", which is basically RPM's equivilant of Godzilla. The Protector then proceeded to start kicking ass.
-
Anarchy started to shake a little more... then for some reason, he started to laugh uncontrollably. He had obviously become delirious and insane. He fell to the ground, laughing. He eventually passed out from lack of breath.
-
*skids to a screeching halt*
Gaia: Damn, I might've been too late. He might need this though.
As soon as possible, he gave Anarchy an antidote to cure his current state. He then waited for it to take effect. Loud roars, screeches, and other unsettling creature sounds can be heard from 10,000 miles away. Landmarks, Oft-Frequented Places and Homes were attacked, leaving property damages to skyrocket.
But Gaia had a possible theory implanted into Anarchy's brain that Stocking and the others might've been kidnapped, thinking that "mii guy" had something to do with sabotaging the other racers to win.
Item Used: Anti-Insanity Potion. Cures Mental Instabilities and helps pervent further mindbending incidents inside the body, was accidentally made when experimenting on a mongoose during reasearch for anti-venom.
-
(We have a protector?)
"Ok guys, you know what to do."
Sieg sweatdropped. The four knights and Temnota then proceeded to do a group pose.
"We are the noble judges of the great race of RPM!"
"*sigh* Ritter Sieg!"
"Ritter Sonne tee hee!"
"Ritterin Stolz!"
"R-Ritter Schimmer!"
"Temnota"
THe group did another set of poses before standing completely straith.
"Welcome onboard the Edeleisen.Here you are safe...."
An alarm went off.
"Miss Temnota, it appears some unknow force is invading Sparkvenia."
Reported Stolz.
-
Anarchy was cured, but he was still unconcious. It was going to be a while before he would wake up.
Suddenly out of the distance Panty ran to the two.
Robot guy, whats wrong with him? And where the hell is my sister?
Panty then saw the Bloody hair ribbon.
Oh [tornado fang]! We need to find Stocking before its too late! Where do you think she could've been taken?
-
Meanwhile.
"Another demon attack?"
Asked Silan who just got the report from the Edeleisen.
"I cannot allow it. Mace, Whiteknot!"
A samurai and a white clad ninja appeared behind Silan.
"The race cannot allow my people to be attack and also this race shall not be interrupted. LEt's go!"
"You too misstress? But that's..."
Asked Whiteknot but was interrupted by Mace.
"We just have to find the leader and I am sure the misstress can defeat the leader the fastest."
Blackhook was waiting for Mr. Hatter's answer..suddenly he felt something dark in the distance.
"What is this feeling...."
-
Anarchy was cured, but he was still unconcious. It was going to be a while before he would wake up.
Suddenly out of the distance Panty ran to the two.
Robot guy, whats wrong with him? And where the hell is my sister?
Panty then saw the Bloody hair ribbon.
Oh [tornado fang]! We need to find Stocking before its too late! Where do you think she could've been taken?
I don't know, but I have heat sensors. I should locate Stocking's heat signature in no time. However, we need to get there fast. Plus Anarchy's cured thanks to my Anti-Insanity medicine.
Elsewhere, the Protector continued to fight off the evils that were aiming for RPM. He then proceeded to claw into his foes.
Skkkkr... RRRROOOOAAAAWWWWRRRRRRRGGHH!!
Dark Angels began exploding, along with the ghosties in the process, because unlike most, claw swipe projectiles eminate from his claws, rather than a beam breath.
(We have a protector?)
(Don't all universes have at least one protector? It makes sense for RPM to have one..)
-
(We have a giant satelite canon, agiant enemy crabs and the anime tenchou...meh,, we can have Godzilla as well)
-
What if she's already dead? Then we won't find her, heat signatures be damned, we need to find something out of place!
Panty then looks at the sky, noticing the air ship.
What about that thing? Scan that thing.
-
(You can't find heat signatures on the ship :P)
-
(Is that an ass pull? Or just common logic?)
-
(It was designed not to be detected by radars or other devices...curtesy of DWII)
-
(So... you can't see it by just looking at it either? Or can you still see it?)
-
(Well..you shouldn't be able to...Let's say Panty can see it because..Angel sence?)
Meanwhile the sparkvenian army was succesfully fending against the ghost army.
Silan and her companions teleported near to a SP general.
"Were the leaders found yet?"
"Misstress? No, not yet..."
-
(Ok, sounds good.)
Panty grabs Gaia by the arm and pulls him onto a motorcycle she just happened to have. She also pulls Anarchy's unconscious body onto the motorcycle
Hang on Tight! We're going to ram that thing!
Gaia looked at her in confusement, what was she talking about?
Panty revved the Motorcycle and accelerated quickly, hitting a nearby ramp and flying upwards, directly towards the flying airship.
Hang on Sis! We're going to get you out of there!
The Motorcycle crashed into the ship, with no damage to the ship. Panty was able to hold onto the side, only barely, she grabbed anarchy's body and used his drill arm to hold them up. She then hopped to the nearest entrance and opened the door. Pulling Anarchy and Gaia in, who was barely holding on.
-
Gaia: JESUS CHRIST PANTY! Tell me when you are gonna do these crazy stunts next time, will ya?!
Elsewhere, in the ship, the Demon Sisters happened to be on the ship at the same time as Panty and the others did, so now it's a race against time to save Stocking... and keeping EVA-01 from going berserk.. As the blimey bastard Corset stole the Eva unit by sneaking into the hangar of NERV and sneaking it out of it's own universe; it's only a matter of time before the OGs show up..
UNIT INFO:
Unit Name: EVA-01
Pilot Corset-2.
Background: Stolen from the NERV docking bay by Corset and was given to his clone, so that way he can be bothered not to fight whatever is going on at RPM. The EVA has been re-fitted to both Corsets' liking.
Arms: Claws, SMG, Jaws, Horn, Knife, etc.
-
"5 intruders on the ship..."
Reported Schimmer.
"5? So, everyone gets one?"
Asked Stolz who was ready for a fight.
"I hate to say this...but intruders have to be dealt accordingly..."
Said Temnota.
The knights split up to look for the intruders while Temnota stayed with Stocking.
-
Unknowingly to many, Corset and a pair of Dark Angels come hiding from the shadows..
Corset: Mr(s). Temnota... How are you good sir, would you care for a.. deal? It's about the fate of the universe, no, the whole multiverse. Every grim evil has been targeting your ship. So unless you comply, there would be consiquences.
-
Hmm... where could she be... Lets try to find our way to the cockpit. Carry him with us, he wont be any use laying near this door unconsious.
Gaia grabbed Anarchy and threw him over his shoulder.
The two proceeded foward, hoping not to set off any alarms or run into the Demon Sisters.
(Tenmota is Female, from what I gather.)
-
(Ok Gaia..What the eff? He was with EVA and now he is on the ship? No! Just No!)
-
(Corset was smart enough to clone himself, so it makes it LOOOK like he was at two places at once, let me clear it up a bit with a bit of prolouge time)
Gaia: Alright, as long as we don't do that.. hopefully.
Carrying an uncounsious Anarchy, he follows Panty to the cockodoodledoopit, with the Demon Sisters just on the other side of the bridge.
Kneesocks: Scanty, can we rest? This thing is huge.. *pant*
Scanty: Maybe, we could have a little teabreak. Fastener, break out the table.
Fastener: FA! *everything's prepared for tea, and they all proceed to rest for a bit before persuing again, reducing risks of running into old foes*
*awhile back before the invasion*
Corset is looking at himself.. or so it seems. It's a clone of him, with his personality, his likes, dislikes, and what makes Corset.. Well, Corset. He then checks the portal to see if it's ready, but only to find the two Demon Sisters bitching at one-another (for the fact lack of angels=lack of sanity for them). Of course, that lead to the humorus scolding earlier before they invaded.
-
"Oh joy oh joy! A tea party! You see that Schimmer? Can we join?"
Sonne and Schimmer came across the devil sisters.
"I'm sorry Sonne-nii, but we have to get rid of the intruders."
Schimmer then used his A-trans and turned into Model ZX.
Meanwhile Panty and Gaia came across Sieg and Stolz.
"Halt right there fiends! This is restricted area you have to...YOU!"
Stolz recognized Panty.
"I warned you once...now prepare yourself!"
Sieg sweatdropped when Stolz turned into her OX armor.
(I am ignorring Corset.)
-
(Some Canon correction must be made, I'll continue with my part.)
Gaia was trying his best to carry anarchy over his shoulder, however due to all the equipment Anarchy had on him he had trouble balancing. And thus knocked Anarchy's head against the walls plenty of times, followed by dropping him on the floor.
What the hell are you doing? Don't you know how to carry an unconscious person?
But that didn't matter anymore, Anarchy twitched a bit and finally woke up...
Oww... My head, what the hell happened? And where are we?
We're in an airship. We're going to go save stocking!
We are? Oh good, I was wondering where she went.... who are these people?
Anarchy looked at the two knights.
You ready to dance?
Anarchy pulled out his Katana.
This won't be easy, you ready?
Please, I've faced this [sonic slicer] before, I know how to take her now.
Gaia simply prepped himself.
[Now then, no godmodding.]
-
Gaia readied himself with his buster cannon. He looked at the odds.
Gaia: If we figure out their weaknesses, we can exploit them and win this thing, deal?
ELSEWHERE..
Scanty: Oh dear, it seems a few party poopers are trying to ruin our fun, shall we?
*Kneesocks brings out the insta-ghost liquid, and pours it on a few bolts removed from the ship to create ghost bolts*
Both: Ghosties, sic 'em!
-
Yes, if we exploit their weaknesses... you can solve that.
Anarchy handed Panty the Machine Buster.
Your weapons have no effect on humans. Use this, its deadly force should be enough.
Alright then, but what about you? This is your weapon.
Me? I'm not fighting these assholes! They're in the race, I harm them I'm disqualified. I have better things to do.
Well then, good luck. Stocking is in your hands, then.
Anarchy ran past the two knights and continued down the hallway to the cockpit, Katana in hand.
-
"Hold on Stolz."
Sieg stopped his sister.
"Whaaaat?!"
Sieg pointed his two-sided lance at Anarchy.
"You are a racer, this place is off limits. If you don't want to be removed from the race please leave this area."
Meanwhile. Sonne used his cape manipulation and Schimmer his abilities as model ZX to easily dispatch the ghosts.
"Maaaan, no fun. This guys ain't as tough as the once we fought earlier..."
Complained Sonne.
-
Anarchy removed his racer badge and left it with Panty.
You have no authority over me! I'm going to save Stocking if its the last thing I do! Now get the hell out of my way! I have no time for cannon fodder like you!
Anarchy used his Jetskates to speed up, taking care not to hit any walls. He was just moments away from the cockpit.
Hang on Stocking! I'm almost there!
-
"Sieg...that guy is serious."
Stolz looked at her brother.
"I get the feeling he thinks we mean harm to his friend...I hope he won't attack miss Temnota. SHe would utterly destroy the poor lad."
They watched as Anarchy speeded away.
-
At the cockpit..
Corset: Ahh, who might this little darling be, coming at us at full speed? I pity thy fool. I will fight him myself while you think this over, 'mam.
Corset slowly then proceeds towards the corridor in which should Anarchy reach, he would be prepared.
Corset: Let's have fun shall we darlings? Take form of the intruder's dearly beloved, let's see if he can fight illusions! GET HIM!
During the slaughterfest of the ghosts, Scanty wonders when will they challenge them. Kneesocks then replied that when Teatime's over, then they'll attack. So they create even more ghosts using inanitmate objects.
We now return to Gaia and Panty's position.
Gaia: Panty, care to do the honors of first strike?
-
Anarchy got to the cockpit, he crashed through the door as if it was made of tinfoil. He looked around, it was empty except for one person.
You..... What have you done with Stocking? Where is she?
-
A mysterious, bulky shadow looms over Anarchy.
Corset: Oh, you mean her? And while I'm at it, someone has been waiting for you on the other side patiently, so.. she's been waiting here all day for you too~
*corset shows Anarchy a fake Stocking, along with another fake who looked too familiar too him to ignore*
-
[I thought we were going with the "Corset isn't in the cockpit" that Blackhook went with?]
-
[Since neither of you have selected a number, I'll choose one for you. Anarchy is 3, Brocky is 2, Garm Dasce is 4, Blackhook is 5 and Random Guy is 6. *Rolls die*...Huh...I was kinda hoping we didn't go to the expected funny guy]
After inspections were complete, the Lakitus took the fake badges and threw them away. The only token left was the one that brightly glew inside Brocky's stomach.
"...I tough it was a stone crumpet..." Brocky said, as he rubbed head.
"Congratulations, Brocky Bulldawg! You just won a massive amount of points, putting you in the lead!" Mr.Hatter shouted joyfully.
The monitor then turned to a channel showing the current score of the top 30 racers.
[spoiler=Top 30 racers]
1st - Brocky Bulldawg - 500 pts
2nd - Anarchy - 250 pts
3rd - Blackhook - 150 pts
4th - Adante - 75 pts
5th - Sachertorte - 50 pts
6th - Hobo Frank - 25 pts
7th - ST - 24 pts
8th - Random Guy 1 - 23 pts
9th - Random Guy 2 - 22 pts
10th - Mr. Potato Head - 21 pts
11th - B.C. (Bishounen Caveman) - 20 pts
12th - Blue Sniper - 19 pts
13th - Agent J - 18 pts
14th - Billy Joe - 17 pts
15th - Afro Man - 16 pts
16th - Dr. Groove Machine - 15 pts
17th - Cruiser - 14 pts
18th - Waddle and Troll Rex - 13 pts
19th - PKMN Grappler - 12 pts
20th - Duke - 11 pts
21st - Rankiryu and his Muscle School Boys - 10 pts
22nd - Helga - 9 pts
23rd - DigDug - 8 pts
24th - Pinky - 7 pts
25th - Cloaked Woman - 6 pts
26th - Rapper de Oro - 5 pts
27th - Voldo - 4 pts
28th - Hermascus of Owleye House - 3 pts
29th - Sonic - 2 pts
30th - Afroshroom - 1 pt
[/spoiler]
"Weeell, I think it should be fair to warn the racers with the highest points to watch thier backs, since you might be targeted by the other racers who are willing to get rid of the competition. Just thought I'd bring that up." He said with a huge grin on his face.
"Anyway, CONGRATZ TO THE WINNERS OF THIS ROUND!! Now then if you can follow this disres-wonderfully helpful lakitu who is willingly holding this 500 pound monitor by himself, not in a way of punishment for eating my last doughnut snacks during the race, to the ruins up ahead, we can start the second track! Kyo HO HO!"
After saying his rather short speech to the winners, the lakitu hurridly flew towards the entrance to the God Complex Ruins.
-
[You never told us to choose numbers, you just said it would be a dice roll.]
-
Temnota became nervous.
"What should I do? Sil will be mad at me if she finds out about the people enterring her ship..."
Sieg looked at Gaia.
"Attacking is useless...you are far below our fighting power. It would be wiser you'd left this ship"
3rd place..not bad. Mumbled BH and looked around. HE couldn't find Anarchy anywhere.
-
Tenmota wasn't it? Do me a favor and tell me where Stocking is! I know somebody here took her, I'm taking her back with me! Nothing is going to stop me now, once I take Stocking back I'll leave you in peace, you have my word.
Anarchy stood there, but he put his Katana away as he didn't need it.
-
Gaia: Really now? And you just think I'm some average machine? I'll take you on then. First, I'll copy your current level of power so I can match yours.
GUUUWOOOOHHH!!!
And so, Gaia's powers now matched those of his foes, thanks to his unique copy ability, which instead of copying weapons, copies his foe's strenghs and weaknesses, which gives him a slight edge.
[I thought we were going with the "Corset isn't in the cockpit" that Blackhook went with?]
(with so much [parasitic bomb] going on in the ship, why the [tornado fang] not? I moved him elsewhere where he can catch Anarchy offguard anyway. Wow this RP is getting messed up.)
-
[Its just kinda confusing for one room to have two realities, one with Just Tenmota,Stocking and Anarchy and another with Tenmota,Corset,Stocking,Anarchy,Fake Stocking, and Fake Kallen (?). Its best to decide on just one, because I don't know how to RP when I'm stuck in two realities, I'm not posting two different versions of my post either.]
-
(We are retconning that because of all the [parasitic bomb] that is going on...WHY THE HELL IS EVERYONE ON THE SHIP ANYWAYS!)
Stocking was hidden inside Temnota's shadow.
"W-w-whaaat? You weren't supposed to be here!..I mean Stocking? What are you talking about? Did something happen to your friend?"
("Oh god, how did he get here?")
----
"Idiot. I bet you can't copy two people at the same time."
Commented Stolz on Gaia's ability.
-
[@Anarchy:
[And now to throw a dice, pick a number between 2-6. 1 means nobody got the token.]]
-
Just give me stocking.... I know she's here...I told her I would save her, no matter what, if she got into trouble, if I left now. I'd have lied straight to her face. You don't understand, but I need her, shes important to me.
Anarchy just stood there, his face motionless like a statue.
[@ST, oh, I guess I didn't comprehend that correctly.]
-
Gaia: I may not, but I can do this!
Gaia, knowing his opponents might duplicate themselves, has mastered the pokemon move pursuit. It should come in handy..
(Everyone's on the ship because of Stocking, who apparently somehow got on the ship and had blood on her ribbon)
-
[so once again, another RP I accidentally ruined, Sorry guys!]
-
Temnota looked at him with mistrusting eyes.
"How can you be sure she is here? This place is used for monitoring the race. We are just making sure things are running smoothly."
She pointed her finger at Anarchy.
"You barg in without any evidence and accuse me of kidnapping? Just for that I should k-k-k..hurt you!"
SHe came closer.
"Also those are some strong words you've used there. Though, you don't look like someone who can keep those words"
----
(D-duplicate? There is two of them >.>)
Stolz pointed her charged buster at Gaia and fired, sending the robot flying trough the hallway.
"Idiot..."
[Noone was supposed to be on the EFFING ship..it was supposed to create some drama...sigh]
-
[Again, I'm the one who started with Stocking going missing, so technically I can have my characters on the ship, that makes sense in the least.]
Its instinct, Besides, I didn't come here on my own, I was dragged here by Stocking's sister, Panty. She knows that Stocking is here. I never accused you of Kidnapping, I just know somebody here took her.
I can keep those words, I said I would save her and I am going to do just that, even if it costs me my life.
And don't try and hide the fact that you said you should Kill me, if you feel like you need to....
Go ahead, I welcome death, I've lived in this mortal coil for too long, either being saved from the brink, or being revived. I've never actually died. So go ahead and kill me if you want to.
-----
Will you stop messing around? Its clear this battle isn't going to go anywhere.
Panty just essentially said "Screw it" and walked over to gaia, picked him up, and walked to the exit.
If you see Anarchy, tell him I owe him one for saving my sister. That is, if he succeeds.
The two jumped out, as they weren't needed up there anymore.
-
"Men, first you talk about rescuing someone and now you want to die? How foolish are you?!"
Temnota pushed Anarchy to the teleportation pods. Temnota turned her face away from him.
"Go away, I can't look at your face."
Anarchy was teleported back to the stadium.
-
So.... I failed.
Where's Stocking?
Gone.
Go back and get her then!
Whats the point...
Whats the Point? She's my damn sister! You said you would protect her no matter what, and you're just going to give up?
Guess so... I was a fool to think I could do anything to save her.
You-! You're so [tornado fang]ing pathetic! You don't deserve Stocking! You're going to just quit like that? Just going to say she'll be fine? She could be dead for all you know! You don't have any soul... Why would she like you anyway? I don't understand you! Whats your problem? You act like some mysterious person but all you are is a pathetic coward, you act like that [tornado fang]ing Ikari kid!
I played god once... because of that... I lost everything that made me human... I tried to get it back, and I thought I did... Stocking helped me, but shes gone too... I won't play god again to bring her back.
Once? What did you do?
Before I came to your world I had met the most amazing girl, she was everything a guy could want, strength, smarts, ravishing beauty... She died in my arms... I became Callous, made a clone of her, she was almost the same, her personality was shot though... I couldn't truely love her...
Anarchy pulls out a ring, its charred slighty, but is silver, with a red jewel in it.
I see... This is pain you've felt before then... Hmph, no wonder you're such a damn pussy. I could notice it a mile away the first time I saw you.
Anarchy took the Race badge from Panty, he looked at it in disgust and left it with the Blonde.
If you'll excuse me, I have something I'm going to do.
Anarchy skated away, if he couldn't save stocking, he had no purpose. He skated to a nearby cliff and looked at the sky. His involvement in the race, at this point, was postponed indefinitley. He saw the bleakness of everything calming in a way. It perfectly described how much of his life actually meant anything, it was grey, neutral. He could be erased from existance and nobody would know any differently.
Maybe he isn't just pathetic... there might actually be something wrong here... Not that I should have to worry about his problems.
-
(Yeah, but remember that OTHER time during an RP that was supposed to run smoothly, and that didin't end well..)
Gaia fired back at her, full force. It was fortunate he was able to brush off the damage with Barrier 200, since his CPU Combat System is compatible with the PET's devices..
Formadble, yes. But he is unsure how he'll keep up fighting the attacker AND her spawn at the same time..
(shall we retcon this too and start over? This RP needs rules, no really. It does.)
-
(Panty pulled you off the ship. That battle ended. Why retcon? I want Anarchy to have his BSOD.)
-
(Yeah, so far the race plot's been a bloody mess. I think the story needs re-organizing and hot damn, we need some ACTUAL rules. A rule-free Busy World can't go on forever, we need limits I'm thinking RPMVania's gonna be more successful than this, as it's more, well.. controlled than Busy World..)
-
[So like, is this RP officially [tornado fang]'d over? I mean, it could still be salvaged, its not like the next race HAS to start right now, right?]
Anarchy sat at the edge of the cliff, throwing rocks into the nearby lake. Panty pulled up nearby.
C'mon, lets get going.
Anarchy stayed where he was and continued throwing rocks into the still water.
Didn't you hear me? Don't you have a race to be worrying about?
Anarchy sat.
If you don't stand up I'm just going to leave you here, then you'll really be all alone.
Anarchy stayed sitting. Panty started to get frustrated.
Look! Here's Stocking! I saved her, see? Look!
Panty held up a poorly made dummy of stocking and tried her best to mimick her voice, and failed miserably.
"Hey RMZX, I'm back, don't have to worry about me because I'm fine!"
Anarchy sat. He was not fooled that easily. Panty was pissed now.
Thats it, enough coddling. You're coming with me whether you like it or not.
Panty grabbed Anarchy by the shoulder and dragged him to See-Through, then tossed him in back. She then drove off.
Look, I know its tough for you, its tough for me too. She is my sister afterall. We'll find her, trust me.
Anarchy was still, it was almost as if he was asleep.
-
[Rules? What we need is to use COMMON SENCE a lot more...and less g-modding. Mostly this RP is a place to let off some steam. No need to take it overly serious but as I said-no overdoing it.]
-
[was I overdoing it?]
-
[A little..also using an actual anime character as your love interest...kinda derailing said character]
-
[Alternate versions? Jeez, I can't make original love interest characters. I mean, derailing characters from fiction/using them in odd situations is what Doujin writers do all the time. Also, could you tell me where I overdid it please? Improvement of my RP skill would be appreciated.]
-
[For a RP like this? Don´t try to overshadow other characters and go with the flow. If it makes for a good read then do it]
-
[Oh, well that makes sense. I've been trying to make my character less of a Mary Sue, though honestly I don't think that's working so well. I'll just try and continue what I'm trying to go with right now and see if I can get any sort of decent writing out of it.]
See-through stopped at the stands.
Snap out of your funk. You don't see me moping around just because my Sister is missing. You're too emotionally unstable.
Anarchy still, as he has been, sat there, not moving, not even trying to do anything.
If you had been taken instead of Stocking she would've already saved you by now. You gave up, you were within a few feet of saving her and you just gave up, you fell to your knees and let them remove you from the ship. You didn't even try to fight, You were completely [tornado fang]ing worthless up there, I could've saved her no problem, but you had to try and be reasonable about your actions, you need to man up and actually try to negotiate if you do [parasitic bomb] like that again, if not you need to fight. If you almost die trying it doesn't matter as long as you win the day! You need to be strong, but lately it seems like you're just pathetic.
Anarchy slowly got up, walked over to the stands where Stocking had been sitting, and sat next to her spot. His face, still, like it had been carved out of marble.
You're not even listening to me are you? You don't even talk and you're annoying!
-
Inside the Edeleisen.
Sonne and Schimmer managed to capture Scanty and Kneesocks (Since the two were more paying attention to their teabreak and locked them inside a prison cell.
"You will stay here untill miss Temnota decides what to do with you."
Said Schimmer and the two then returned to the bridge.
Temnota released Stocking from her shadow.
" It´s tiring to hold people inside my shadow..."
The whitehair kept watching Anarchy on her screen.
"...sigh, I am dissapointed..."
-
Stocking blinked and looked around.
Wh-where am I? Who are you? Why am I here? Where's Anarchy?
-
(..huh? we didn´t retcon that part...hehe, though we can make this even more interesting.)
Temnota looked at the girl with confusion
"What are you talking about? Have you alredy forgotten about this place? (Oh no...I hope my powers didn´t somehow mess up her memory...)"
The sparkvenian army has successfully defeated the majority of the attacking ghosts.
"Was this a planned invasion or was that just a random attack?"
Wonderred Silan since they haven´t found the ghost leader yet.
Anarchy was approached by Blackhook
"Hey there, where have you been? You heard the news?...huh? What´s wrong?"
-
Panty responded to Blackhook instead of Anarchy
Don't bother talking to him, he failed to save his Girlfriend and now he seems to have given up on everything...
Stocking looked at Temnota with slight worry.
I've never been here before, I need to leave, Wheres my hairbow?
Stocking panicked, and tried to find an exit.
-
The four knights returned to the Edeleisen's bridge.
"Reporting that we've taken care of the intruders!"
Reported Sieg.
"That's great and all, but everyone, we have to do the introduction routine!"
The knights were confused by that order but decided to obey anyway.
"Ok guys, you know what to do."
Sieg sweatdropped. The four knights and Temnota then proceeded to do a group pose.
"We are the noble judges of the great race of RPM!"
"*sigh* Ritter Sieg!"
"Ritter Sonne tee hee!"
"Ritterin Stolz!"
"R-Ritter Schimmer!"
"Temnota"
THe group did another set of poses before standing completely straith.
"Welcome onboard the Edeleisen.Here you are safe from the evil deeds of my collegue."
Proceeded Temnota.
"Also, you will be of great help for me to find out the truth about the so called 'Anarchy'...it wasn't that long since the marriage..."
(The marriage is still listed as a major arc of the previous Busy World so...no retconning for you 8D )
-
(It was a sub-arc to a main arc, If you read my first post in this RP you'll see why I "Retconned" it.)
Inside Anarchy's Psyche...
A man sits on a chair, its worn, slightly broken. The man is Anarchy, originally known as RMZX. A spotlight is cast on him, the rest of the area is nothing but complete darkness.
A question appears:
"Why do you fight?"
To protect the people I care for.
"Why have you lost your will to live?"
I've lost Stocking, theres nothing I can do to save her.
"You've lost somebody before."
No, I haven't.
"You've lost somebody before"
Yes, but I saved her.
"You've lost somebody before"
Yes, but I brought her back.
"How?"
She came back of her own will.
"How?"
She was brought back by me...
"How?"
I made a clone of her in case the original died. It was foolish of me.
"Why don't you try again?"
Because I don't want to.
"Why not?"
Because I felt no love for the clone.
"Why not?"
I didn't feel any emotional attachment.
"Why did you love Stocking?"
Stocking gave me my humanity back, I felt like I could be happy again, I felt I had somebody to protect, in the end, all I did was fail... again... I won't make the same mistakes I did last time, It'd be better if I didn't exist at all.
"You're Wrong"
No. I'm not.
Suddenly, apparitions of people Anarchy has known pop up in spotlights around him.
You don't even try more than once at anything, how could you be so sure she is dead?
Her hairbow was stained with blood.
You're really going to give up? Why did you even bother trying?
If you are going to try and run away from all of your problems then you will get nowhere.
A 4th apparition appeared, her red hair made her identity painfully obvious.
You don't even adknowledge the fact that I cared for you anymore. You seem to regret the time we spent together.
Because I couldn't save you from dying.
You would've been better off not getting involved in the first place! You felt like you had to be the big hero and all it did was get the one person you cared for killed! Then you made some shitty clone of me, you spat on my face essentially, You couldn't just keep me in your memories like a normal person. Now you have a chance to save your new loved one and you won't even go and save her!
I did try.
There is no Try.
There is only...
Success...
And Failure...
I don't want to carry this burden... I JUST WANT IT TO END!
Then end it...
End it all...
you're just going to let down everybody who cares for you. again.
Back in the outside world...
Hm, just as I figured. He appears to have gotten locked into a psychological stare-down. He can't save himself from his own BSoD.
[Oy, sorry bout that, I got NGE episodes 25 and 26 in my head. So I kinda did the same routine.]
-
(Umm, just outta curiousity, was the orange text moi? Because it was prophesized, I did actually have friends (Anarchy Included) after the madness that was yester busy world)
Gaia: Ermm, what just happened now? God I need to stop taking these.
*throws a few energy cubes off the cliff*
-
[I actually don't know who orange text is, I thought it'd be nice to have somebody in there who isn't Panty, Stocking, or Kallen. So if you want, by all means feel free to consider yourself orange text.]
-
Blackhook offered his hand.The wind became stronger around the two.
"Grab my arm and stand up! You said you had your reasons for entering this race.Are you going to give up now, when it only started? Will you give up right after the first problam appears?"
Some flashbacks returned to Blackhook
("You want to fight Roa? You've guys have some guts. Well I guess I can give you this, it might come in handy."
Blackhook gave his gauntlet to a man who was acompanied by a red haired woman.)
The wind around them become even stronger.
"You can lose a lot, but noone can take away your heart and will, the only way to lose those is to throw them away! Now STAND UP!"
Silan pondered about the situation.
"It looks like those demons attacked not only Sparkvenia but RPM aswell. I don't want to handle this situation alone. I have no choice, in case it's a larger attack I have to contact Flame!"
Silan ordered her men to contact Flame.
-
Anarchy looked at Blackhook, his eyes were empty, but he stood up. He said nothing, however, as his motor functions and understanding of speech were fine, but his mind was still gone. It was like he was in some sort of "Auto-Pilot" mode.
Stocking was still on the airship.
Please, you have to let me leave. I need to be cheering on Anarchy, he needs me.
-
"You see that's..err..ah...I mean..."
Temnota was looking for the right words but then Sieg stepped into the conversation.
"Cheer on him? As far as I cen see the two of you shouldn't have even met to begin with. The boy doesn't need you, he needs something else since you can't always be there for him."
"Your body is standing..but what is fueling it? An soulless body shouldn't exist."
The surrounding wind started gathering around BH's right arm.
"You flame has been put out, I guess I have no choice. Even if I have to use force, I will put the fire on!"
BH prepared a punch.
"SCHLAG DER VERNUNFT!"
BH's used an uppercut on Anarchy and sent him flying towards the sky.
"Reach the sky!"
-
Stocking was taken aback by Sieg's words.
He doesn't need me? Why in the world would you say that? I'll always be there for him, I care for him. Besides, what else would he need? He has somebody that loves him and he has friends, he is happy.
Anarchy soared through the sky, while in his psyche.
Its time.
You need to go back now.
Reawaken and save what you care for.
Do it for all of us. The world needs you.
I guess... If I'm needed, then I must go. Farewell.
Anarchy's eyes lit up. he spun in the air and managed to make himself less aerodynamic using his cloak to break his descent.
He landed on the ground perfectly.
Lets go.
Oh hey, would you look at that. He's back.
-
(I think RMZX needs to watch Kore Wa Zombie Desu Ka? It may be UNBELIVEABLY whacked out, but it should give him an idea how to keep a character that's already dead amognst the living.. then again, Garterbelt died once, and became a missionary and thereafter following a surreal resurrection. So there's two options there~)
As the retonconga event continues to happen places here and there.. poofed, vanished, as if rectonned from a story. The monsters began heading home too, since there is no longer a purpose for them to stay here. Athlough, a few decided to make their stay and continue havoc. As the ones currently attacking Sparkervania AND RPM, while the Protector continues to fight the remainder of the monsters, hoping to find their leader.
-
(The only retconned thing was COrset appearing on the ship >.<;)
"Now I can't wait for the next phase of the race."
Said BH and returned to his little boat.
---
Many people noticed the little 'conversation' between Anarchy and BH.
Adante:"Miii,miii? I wonder what happened? Oh well never mind. It doesn't concern miiiiii ♪"
Sachertorte:"Ok Pfeferkuchen, this round will be our. You see that guy? I will get his head."
Turbo X540: "Another flashy one? My fireworks will rule the next round!"
Spark 5(in unision):"SPARK JUSTICE!"
---
Troll Rex was all fired up for the next round.
"Ok little one, next race is our! Hey, how about when we get close to finish, me throw you so we win faster?"
---
A. Silan - who is using the alias Nalis - did the last upgrades on hers and Afroman's vehicles.
"Mr. Afro? I felt a slight disturbance? You felt that?"
---
Silan:"You still have no contact to Flame?!I need to return to the stadium!"
Sparkvenia soldier:"Don't worry misstress, you won't have to wait any longer. We know his position, we can contact him now..."
---
On the Edeleisen
"Misstress Silan explained dimensional travel to me."
Continued Sieg.
"I don't care about love or any foolish emotions like that. I just know that people shouldn't meddle with other dimensions. It's for this reason this universe went trough a 'reset' just recently..."
-
How does that have anything to do with him needing me?
Stocking, now extremely frustrated at the Knights apparent lack of explaining answers, Changed one of her stockings into her Angelic Katana, Stripes I.
Now if you'll excuse me, I have somewhere I need to be.
Stocking walked towards the door and left through the hole Anarchy busted through.
-
"Idiot, he cannot rely on you...you leave and you'll die..or maybe something worse."
Continued Sieg.
"But unlike misstress Temnota here, we aren't concerned about that.Neither do we care about the man. Remember though, if your presence somehow disturbs this place...we won't show any mercy.It's not like you can do anything against it, since your weapon cannot harm us anyway."
"B-but Sieg! You can't let her just go like that!"
Argued Temnota
"Miss Temnota, you shouldn't have meddled with them in the first place. Mr. Adante can do whatever he feels like...but you, you got orders from Misstress Silan. Your job is to be a judge, nothing more."
-
Stocking walked to the exit, she noticed the door was wide open, and that a drill had been jammed into the hull.
So he was here, I knew he would try to save me. But they must've tossed him down or something.
She jumped off the airship and floated down gently, Landing behind the stands.
-
At that moment, Gaia was also at the stands, after he threw out the supposedly rigged Energy Cubes, unaware that some leftover monsters have been wreaking havoc on RPM and Sparkervania. He then sees a familiar person.
Gaia: Ah, Stocking! Everyone's been hunting you down like madmen! It was crazy too.
-
[Oh [tornado fang]ing firefox, I had my whole post written out and The damn thing closed out for no reason.]
Anarchy heard Gaia say something about Stocking, he blinked in disbelief.
Impossible.... Stocking?
Before he could turn around to look for her, he felt somebody hug him from behind.
Anarchy! You're OK! I thought they got rid of you! I was worried.
I'm the one who should be worried, I thought you were dead... When I got on the ship I didn't find you and that Tenmota woman threw me into a teleport pod.
I think she kept me hidden in her shadow, it was cold... and Dark...
So it did involve her, stupid [sonic slicer] tried to throw me off.
Anarchy then stopped, and reached into his pocket.
Before I forget, here. Its a little stained, but It should be fine.
He handed her the Hair Ribbon she had lost.
I was going to keep it with me as a memory if I was never going to see you again, but you're here now. So I have no need to hold onto it anymore.
You didn't really think I was dead, did you?
Stocking quickly put her bow back in her hair.
I did, but that doesn't matter now since you're here now.....
Thanks for holding onto it for me. Now you have a race to go to, don't you?
Indeed I do.
Well, good luck. You're going to need it.
Anarchy smiled, then in an act of impulse he pulled stocking close and gave her a kiss.
Sorry, I don't know what came over me.
Stocking just giggled a little.
I'll be here for you when you get back, don't worry about me. I'll be fine, I have cheesecake to keep me company.
Anarchy Smiled again, then he dashed off to the location of the next race.
-
Gaia then asked Anarchy a question.
Gaia: Well, now that's over and done with, there should be at least NO interruptions, no?
-
Anarchy continued skating off to the next location, the God Complex ruins.
Alright, I know I'm going to get slammed for this, but honestly, why God Complex ruins? Was somebody fitting the description living here? On the other hand, very nice looking.
-
(Sorry about giving that sad excuse for an intro post then leaving. What're we up to?)
-
(Still races, RPM vs. Sparkvernians, Me being a generally pathetic mary-sue *Trying to Fix that*, drama, comedy, you name it.)
-
(So what do I do. Just throw in a bullcrap post about how I "arrived near the others" and go on from there?)
-
(...remembers the RPM fortress Rp...*shudders*)
-
(my god that was terrible. You should've seen the many times we had to press the damn reset button for this arc, while we were waiting for the founder of this arc.)
-
(*Sigh* What'd I do now?)
-
(Nothing. But you should've seen how many retcons we pulled off during the "Rescue Mission" sub plot. We are just waiting for someone to continue the story again. Current Location: God Complex Ruins)
-
(Number of retcons...1... -AC)
-
(Alright. So should I wait out the arc or haul butt into it?)
-
(What ever you wish. Make sure it's logical.)
(Number of retcons...1... -AC)
(But the amount of times we had to write events/characters/etc. out makes it feel like we did more retcons than that.. *sigh*)
-
(I don't care)
(But the amount of times we had to write events/characters/etc. out makes it feel like we did more retcons than that.. *sigh*)
(1...Corset suddenly appearing on the ship...that's all...get over it.)
(What ever you wish. Make sure it's logical.)
( >0< ...anti insanity pills)
-
(Aye... Legitimate introductions are my weak point. Everything on, fine, but the intros! Let's just try this...)
Zero aimlessly wanders, with no particular destination in mind. He just continually walks. He doesn't care what happens as long as it's something that he can find interest in. Needless to say, he's about to find something interesting. He somehow wanders into the God Complex Ruins.
(Bull, I know. Just forgive me for this, and let's move on. I'm just terrible with introductions.)
-
(...remembers the RPM fortress Rp...*shudders*)
(Hey now, that wasn't all his fault. I was to blame as well for that fiasco.)
(1...Corset suddenly appearing on the ship...that's all...get over it.)
(Yeah... that wasn't really a good story twist... for now lets just say he's been written out, same with the Demon Sisters, unless Gaia has plans for them i don't see a point to keep them around :\.)
-
(Well, they did ligitimately cross over VIA demon-made dimensional gate. So I have plans for them. Probably when during sometime in the middle of the third course at the second pass I'll have them a re-debut. For now any ghosties left in the story are either wiped out by the Protector or by RPMgoer/Sparkervanian/Panty and Stocking themselves.)
-
(Hey now, that wasn't all his fault. I was to blame as well for that fiasco.)
(But it was MOSTLY my fault.)
-
(Hey now, that wasn't all his fault. I was to blame as well for that fiasco.)
(I know. Man, I wish ST wasn't so busy with stuff...)
(Well, they did ligitimately cross over VIA demon-made dimensional gate. So I have plans for them. Probably when during sometime in the middle of the third course at the second pass I'll have them a re-debut. For now any ghosties left in the story are either wiped out by the Protector or by RPMgoer/Sparkervanian/Panty and Stocking themselves.)
(They are locked inside the Edeleisen)
-
(Oh, right. I forgot that they warped directly inside. whoops.)
-
[Sorry for the wait, I wanted to make a map for the next track, but I think with a detailed description of the track should suffice.]
The racers were closing in on the ruined site of the God Complex, passing through the crumbling towers and remaining ruble. Seeing a few inactive guardians laying around the area, gathering dust, moss and being used as homes for small insects and animals. At the center of it all, stood a tall building with markings similar to those of the sentinals laying around the place.
"WEEE'RE HEEERE!! THE SECOND TRACK, THE OMINOUS, GOD KILLING COMPLEX RUINS!!" Mr.Hatter bellowed through his monitor.
"Now then, I'm not going to lie to you, this might be a tad bit more difficult then the last race. And I know what you're all thinking; how is racing around the ruins going to be a challenge?. Well here's the drift, you guys aren't racing around it, you're racing in it!"
The racers started muttering to themselves about what the overly eager host had just said.
"I know, you're thinking how are you all going to go inside ruins that haven't been traversed in probably a hundred years or so. SOME of you archeological types are probably saying: how a man as handsome as myself could do such a horrid thing as make this ruins a playing field for the racers." He said with a grin.
"Well those ner-book smart and highly intelligent people shouldn't worry, since earlier my lakitu scouts already checked the ruins for anything of interest. Which there wasn't! (At least nothing that would interest me, myself and I in the least). Which is were I'll tell you how you're all going to go into, race through, and exit this track."
The lakitu holding the monitor flew toward the nearest tower. He was floating above a large hole near the tower which seemed to have led underground.
"The competitors of this race shall enter through this hole here, which has been slightly modified so that most vehicles could safely traverse into the ruins. This path leads to a tunnel that will take you straight to the center architecture thingy. Of course once you get inside the place, you'll find that the path might be a bit mind-boggling. What I mean to say is, it's a maze in there! 2 out of 10 of my lakitu scouts were lost in there." Mr.Hatter took of his rugged top hat and mourned for his lost lakitus...for 2 seconds.
"Anyway, It seems there are 10 paths that branch into 30 separate paths.There are also rumors from my only surviving scout that there may be hidden paths. Only 3 of these paths lead to the northern tower, which happens to be where the exit to the finish line resides!"
"Of course the maze will have a lot of trick paths, dead-ends, full-circle paths, as well as a lot of traps, which took out the other 7 lakitu scouts. Of course, one of these paths may lead you to the 500 point token. So some of you might want to check it out the whole ruins!" He shouted cheerfully.
"And don't worry racers, if you happen to get lost, we shall send scouts to search for you and transport you back to the surface world. If you have perished thanks to one of the traps though...well there's nothing we can do there now." Mr.Hatter fixed his old tie and sipped a glass of water.
"Now then, the challenge for this track. My lakitu scouts, bless their little dum-loyal souls, have left a few flags in some of the paths. There are 15 flags to be precise. To win the extra 250 points, one must pass the finish line with 3 flags. And with that said, I believe it's time to get this show on the road. But before that, any questions?"
-
Gaia: Quick question, why these ruins to be percise..? I have been picking up unusual activity inside my space station from quite some time, and I've been monitoring it since. Will it be any dangerous if one were to awaken any guardians, and of course, the Protector himself?
(Well, I felt that the Protector needs a place to stay, so deep into the ruins would be a perfect place for the beast.)
-
Anarchy stood at the starting line, looking at the ruins, eh, it was a lot of brown and fancy carvings, he wasn't really intrigued, and neither is this narrator.
30 paths? 15 flags? Objective would be to get the flags first then find my way to the exit, thankfully I have a good sense of direction.
-
"So, no good questions then? Very well, very well, let's get this show on the road then!" Mr.Hatter said, ignoring Gaia's worries.
ON YOUR MARKS!!...
GET SET!!...
SET AND A HALF!!...
RIIIIIIIIIIIIIIIIIDE OOOOOOOOOOOONNNN!!!
Instantly, the racers dashed off to the southern tower entrance. Though some have managed to get a head start through the architecture's opening, some were too hasty and crashed on the walls of the ruined tower. The stone building began to rumble slightly as more arrogant racers crashed through its walls.
The archeologist in the audience weeped as they saw racer after racer crashing and ruining the ruined tower. And they could only imagine the damage that was being made inside the God Killing Complex.
[PS: This track is pretty big, so I'll be making that map during this part of the arc. Once the players get into the center building, there will be a lot of twist and turns. I'll also try my best to supervise and throw in those death-traps and such during the race.
Also remember, there are 30 paths, most of them lead either to dead-ends or straight back to the entrance of the center tower, or the starting point of one of the paths. As mentioned before, there are 15 flags inside the center tower, a racer needs only 3 to gain the 250 points, as long as they have it in their hands when they pass the finish line. And of course, only 3 of the 30 paths lead to the exit.
With that said, have fun with in the RP.]
-
Anarchy prepped the Drill Arm, using it to pass through the falling walls unscathed. His choice of vehicle couldn't have been better, the Jetskates allowed him to navigate through the narrow spaces between the racers and effortlessly avoid smacking into random debris.
-
(Can we have Reaverbots lurking inside? 8D)
-
(I don't see why we can't [eyebrow])
-
Gaia continued to rage along with the other archeolgical fellows as the reckless drivers rampaged through the God Complex, where they undoubtingly slammed into into walls where minerals might've rested.
He then began to yell.
Gaia: GOD [tornado fang]ing DAMNIT! (AND I WARNED THE BLIMY BASTARD OF THE IMPENDING DANGERS TOO!) AND I WAS PLANNING TO COME HERE FOR AN ARCHEOLGICAL DIG WEEKS BEFORE THIS BS. I'M CALLING A FRIEND!
*rriiiing*
Gaia: Anarchy, while you're in there, grab me a few minerals from the ruins, I need them desprately for my reasearch!
-
What? I'm trying to win this damn thing! What do you need?
-
Gaia: If you have a chance, slice off a rock sample from one of the statues while you are running around down there, I need a sample!
-
Its just a [tornado fang]ing rock! There can't be anything special about it... ehh all right.
Anarchy quickly used his Katana to remove a chunk of rock from the falling statue, while doing that he was blindsided by a random Reaverbot.
Ow! [tornado fang]er! That hurt!
Anarchy grabbed the rock and pocketed it. Using his drill he pierced through the Reaver's eye and collected the Zenny from it. He quickly regained speed, but due to his slight tussle, had fallen behind a small bit.
SON OF A [tornado fang]! I'll Call you back, I just fell 5 places in the race!
Anarchy shut off the phone and continued to speed up, he was able to get ahead 3 places but was experiencing some difficulty maneuvering from the dustiness of the ruin.
-
Gaia: Ah jeez, that was dangerous. I should've told him that the statues were made of exceptionally rare material, which thou shal not be named, due to it's history.. Shhiiiiiiit, every other archeologist heard me. There goes my project.
-
Some of the archeologist that overheard Gaia's blabber about the ruins rare materials started calling some of their own allies who were in the race. After a brief explanation, a handful of racers each chipped a piece of rock from the nearby statues aligned along the track as they passed them. Knowing fully well of the economical benefits of this archeological discovery.
In between the racers, ST was marveling the architecture of the ruins. Not minding the few and bizarre looking reaver bots that were walking along the roads walls and ceilings
"OOooh, Pretty statues~" He said as he gazed at the stone carvings. The road started to curve and made a spiral route, as the racers descended deeper into the ruins. when one of the statues where chipped, it activated a defense mechanism which made the statue explode, blowing away the unfourtinate competitor.
Soon after, from some panels on the walls, pillars began to swiftly sprout and push away unlucky racers off the track, sending them plummeting down to the debts of the tower ruins. Those who were able to evade the pillars we met with dragon fly like reaver bots that dove down and attacked them.
--------------------------------------------------------------------------------------------------------------------------------
"Oh, the horror! Oh, the exitement! Oh, the rati-irrational misfortunes!
Things that can only be seen on the Dangerous Race of Destiny!! And nothing that can't be fixed with some Pop-corn!!" Mr.Hatter shouted to the audience.
The Lakitus began to go through the crowd with boxes filled with popcorn bags. And they were being sold for 500 zenny a bag.
---------------------------------------------------------------------------------------------------------------------------------
"Kyo ho ho ho! What a great show this has become!" Mr.Hatter said to himself in the comfort of his tent.
"Oh Lakitu, tell me how we're doing in the ratings?" He gleefully asked.
"Well sir, considering that this event is holding a whole country as it's prize, both the local and neighbor country of Sparvania audience are watching attentively from their tv sets. We're over a million hits, Sir!"
"Excelent, by the time we're half-way through the race, will be more popular than 'Everybody Loves Roa'!"
"I think the show is called 'Roa Knows Best', Sir."
"Who cares! We're making tons of more zenny than has-been show, thanks to our filthy rich sponsors!...Speaking of which,I better check with the old coots." The greedy host began contacting said sponsors.
From his screen appeared four silhouettes of four hefty men.
"Hellooo gentlemen, how are you doing? Eating well? How are the wife and kids? And more importantly, are you enjoying the show?" He asked the shadows.
In sucession, each man answered his questions.
"Sickly...*cough*
That better not be an insult of our physique, ya brat!! >8|
They're starving...thanks for asking though.
Good, good...thought there is not nearly enough casualties for my taste. I give this performance two skulls out of five."
'My, my, such criticism, Mr. Dreaderick. And glad to hear that Mr. Colddeen and Mr. Hungrensky...and I would never insult your fa-global figure, Mr. Marssesko."
This conversation will be continued in the next post...
-
Gaia began to think about the current situation, and the increasing amount of competitors for the rare material known only by it's violent history. Which he did think, it was rather stupid to think aloud and ask one of the racers to pluck the sample. He now pondered that his excrutiating reasearch will go to waste, thanks to his stupid habit of thinking aloud. Thing is, he has mapped some of the areas inside out, and knew which traps were placed since his last visit to the ruins.
-
(*Needs to get on RPM more frequently* >_>; )
Afro-man and Agent J were already deep with in the confines of the ruins, soon to near the center. Afro finaly not stalling this time was roughly following a lone winding path,"Why do I feel like im going in circles?" he asked himself.
(Next post'll have more details and shenanigans on my part...really. ._.; )
-
BH was drifting trough the halls of the god complex ruins. Even though he was using the wind to find the right paths, he still felt like lost.
"What a sad place...though it appears there are being other than the racers occupying this place.."
The moment he said that his boat got attacked by four mantis like reaverbots.
----
The turbo 540 X was somewhere deep inside the ruins. The transformer found one of the flags.
"Objective: 1 out of 3 complete...Hehe"
The tank turned around. His sensors noticed a presence behind it.
"Energy reading...power level...exceeding my own?! What is this thing?!"
He started firing at the darkness. The explosions revealed the Ginat Reaverbot hiding in the darkness as it was about to attack the tank...
...The next moment loud explosions could be heard inside the deepest part of the ruins.
----
"Mister Afro-Man? It appears that we lost your alternate self again...Should we find him or continue with this race?"
Asked Chief Nalis who was using some advanced car fu to fight against some attacking reverbots.
----
Sachertorte galloped trough the ruins, one flag already being in his possesion. The bounty hounter then noticed some interesting targets nearby...
-----
The spark 5 were getting close to Anarchy's location..will this be an unfair confrotation?
-----
Adante was standing on the roof of his vehicle.
"♫Miii, miiii miiii ♫"
He listened to his voice echoing trhough the ruins...together with other voices.
"I see miii, now I know the layout of this place....miii"
-
To the archeologists, this was an entirely diffrent race. It was to see if they can aquire the best sample from the ruins and use the sample for their own personal gains.
This of course, made Gaia highly furious. He was not going to lose to an old archeolgical rival, which was from an entirely diffrent academy altogether. He decided to call once again, this time to an old "friend", that's currently within the ruins. His next plan was to bribe him with 50,000 zenny if he can get the best materials extracted from the site. Of course, there are known to be reaverbots in there, so he sent some of the guards inside to deal with them from inside the drillstation.
....Then, there's the sleeping Protector. Awakening him can change the entire outcome of the race, as this is where the location of the ancient tribe made sacrifices to the Protector so they could "feel safe" in the hands of the creature.
The Protector itself resembles a strange blend of a human, reaver, and pokemon alike. Tail of a houndoom, head of a voltorb, a monoeye, and a body skinny enough to be mistaken for an Eva. It also walks on all fours.
-
"AFRO PUNCH!" Afro-Man shouted out as he sent several revarbots flying away from his car. "Yeah...I dont know how he does it. He must be some master of evasion..."
Afro sneezed and rubbed his nose as he looked around, still driving in circles but suspiciously noticed he was going slightly higher,"?"
"...Or maybe not." * -u-'* he said before drifting and running over a random reverbot.
-
Somewhere, sleeping near the exit, lied the protector. That was his domain. To it, the course's entrance is it's exit. It's why there are so many reaverbots there, to protect their leader. One wrong move, it will wake up and cause havoc to any intruder, it's why there are few explorers of this ruin in the first place, and Gaia knew about it. He decided to call again, and warn Anarchy of the protector's whereabouts.
-
Anarchy had to ignore the call, as he was busy slicing up Reavers left and right. Collecting the zenny that came out of them.
Good god, this is monotonus, wish I was fighting something more powerful.
Anarchy looked ahead of him, he noticed a flag that had been knocked over, he picked it up.
Score! 2 more to go!
Anarchy continued to keep going, the sand somehow not making much of a difference to his speed anymore, he was able to edge up to a comfy 2nd place.
-
After hearing a huge ruckus, the Protector woke up after a few racers recklessly rammed into things, causing slamming noises it didin't want to hear. It gave out a warning cry..
"ssssllleeeeeeeeppp.. leeeeeett mmmmeeeeeee sslllleeeeeeeeeepp.."
It also called all the reavers within a 20 mile radius of the ruins to guard it's den. It then went back into a coma-like sleep.
-
Oh, what was that sound? Sounds like me after going to bed at 1:30 in the Morning.
Anarchy turned around, his Jetskates somehow not making him go the wrong way.
Whats this? The rainbow Spandex brigade wants a tussle? Don't godmod on me now, but your ride is going to have a rather splashing time!
Anarchy drops splash mines in the path of the Spark 5 and kicks up a sandstorm using the wheels on his Jetskates.
A crowd Boos.
Oh come on! It was a good joke!
Anarchy sped up to try and avoid the fury of the "Rainbow Spandex Brigade".
-
The racers began their adventure in the maze-like center section of the ruins. While many wound up in dead-ends and had turn back, or fell victim to some of the deadly traps in the ruins, some were lucky and managed to find some of the flags hidden through out the track. 5 of the 15 have already been captured.
One was in the hands of the slightly arrogant, Anarchy, who was chased down by the mysterious and colorful Spark 6. 2 were already in the possesion of Cervantez Cesar Japenocurse you num.pad-less laptop Sr., Garm Dasce had just captured a flag, narrowly escaping a spiked reaver bot pit, and a flag was found by the heavy tank machine, Turbo540X. However it seems communications has been lost with the transforming robot, it is unknown if he still posseses the flag.
------------------------------------------------------------------------------------------------------
While the cloaked jet skate wearing youngster was trying to get away from the supossedly angry, prismatic, tights wearing super team, some humanoid reaverbots jumped onto and attacked the unfocused racer.
------------------------------------------------------------------------------------------------------
"Gaaah. That was exhausting." The caped jester muttered to himself after getting passed the columns of the first section of the track. He slowly made his way through on of the paths, whilst the rest of the racers dashed right past him.
"Ah, good afternoon Strange, fancy meeting you here." Greeted Clockston.
"How you holding up?" Asked Sally.
"Oh, hi there guys..."
"OH MY GOOOD! CLOCKSTON! NIGHTMARE SALLY! YOU'RE ALIVE!!" He shouted, his eyes began to water.
"Strange Man, we have met in the last Busy World, it isn't like we were seperated for 3 more years." Clockston told the emotional maniac.
"Oh, I see...also my name ST...it has a better ring to it."
"Why'd you call yourself ST? What's wrong with Strange Man"
"It makes moi sound like a super hero. ST makes me sound like a super hero! Of the neeew age!" ST shouted.
"Uh...okay, ST."
"Btw, any of our other friends make it to the race?"
"Boo" Said General Crimson
"EEEE-YAAAAAAAAAAAAAHH!! C, C, CRIMSON!! F, Fancy meeting you here...the superior isn't around here, is he?"
"I am the superior, Strange...till further notice."
"I see...gulp"
"So, how are you...have you been lazing about all this time while we were striving to bring back the organization back unto its former glory."
"...no." He answered with
"...No matter, we have some new buisness to attend to. I need you three to keep a watchful eye on this race. Not all is what it seems."
The three subordinates stared at their captain general with confused expressions.
"Of course, it does not mean we cannot enjoy our selves for a bit. If you'll excuse me, I think I will have a little play date with one of the more capable looking competitors" The crimson rider sped up and went to search for this individual.
"...That was weird...and scary."
-----------------------------------------------------------------------------------------------
"So our fish lipped host, have you found any more of the tokens yet?" Drederick asked Mr.Hatter
"*cough* We're dying to know...and I'm being serious about that dying part. *cough*"
"Speak for yourself, Mr. Colddeen. I'm feeling quite peppy...though I guess a five course dinner could be good right about now" Hungrensky's stomach growled.
"Well my lovely, lovely bosses I...still just got the one you gave me. He he." Mr.Hatter twiddled his thumbs.
"WHAAAAT!? O:< You should have had 4 by now! >_<
"Patience, Mr. Marssesko, for a normal being such as Mr.Hatter, gathering the tokens takes much time. However, I must agree that you do seem to be taking your time with this. We should at least have had the second token by now. Your performance deserves a sad face out of 10."
"Oy, such criticism, Mr. Drederick, such criticism. True, I am taking longer than I should to gather this tokens, but you must admit we ARE making a killing out there!" Mr.Hatter said enthusiastically.
"*cough*He does make a point, men. We're making much more *gag* then what we did with our last show."
"WHAAAT!? MORE THAN ROA!? O:< Please, this isn't even making half of what Roa Knows Best! >8| The only reason this is making more money is because of the Underground deals...I miss Roa Knows Best. O:< <(this is his sad face too)
"Sigh, true. The ratings haven't been the same since we hired that replacement. However, that is beside the point. We shall contact you again Mr.Hatter, and you better have had retrieved 2 more of those tokens."
With that the four hefty silhouettes dissapeared from the rugged man's screen.
"Sheesh, I hope they don't call soon, I'm making too much money thanks to games. I might lose some money if I seem like I need to speed things up...gotta think of a way to make these guys hurry it a bit without seeming too suspicious about it..."
Mr.Hatter was lost in his thoughts, thinking of a way to speed things up.
[EDIT: Fixed a few typos and things]
-
[What, it was spark 6? Oh, I think I did it wrong.]
Anarchy was ambushed by the annoying as hell reaverbots.
I don't have time for this! Get off me you [tornado fang]ing parasites!
Anarchy Spun a bit to weaken their grip on him, then he swapped out the drill arm for the Powered Buster and planted a shot into their heads, collecting more Zenny.
I could make a living out of this!
Anarchy's eyes were diverted by an opening to his left, he quickly made his way inside.
Gee... sure is dark in here. Must be a detour! :D
Suddenly spikes started coming out of the walls, Anarchy avoided them, as they were coming out of predicable black boxes.
Please, the only person who falls for those things (Let alone gets hurt by touching the sides rather than the actual pointy part.) Doesn't even live in this universe!
h...help...
A faint voice called for help. Anarchy followed the voice.
What he found was a flag, being held onto by a wounded Lakitu!
Oh, guess they aren't all dead, Hatter must've stretched the truth. Grab ahold!
The lakitu grabbed onto the back of Anarchy's cloak, while Anarchy grabbed the flag, he then sped off.
One left!
The tunnel appeared to get narrower, but before being able to reach the end of it, Anarchy fell into a pit....
Oddly enough, it was rather light, Neither of the two were dead, but rather, it appeared they were in a sanctuary of some sort, compared to the falling apart state of the ruins, this sanctuary was rather untouched.
Whoa, this place is huge...
Who would've known this was hidden inside a decrepit ruin?
The lakitu noticed a small cloud hanging around.
Hey! Its my cloud, if you can get me there I can head back to the race HQ!
Not a problem, it appears I'll be able to climb to it.
Anarchy climbed up the stairs to the cloud, the lakitu hopped on and flew out through the opening.
Thanks again!
Anarchy waved the Lakitu away, and walked into the small room at the top of the stairs....
-
[No, you were right calling them the Rainbow Spandex Brigade. You're probably thinking you confused them with Turbo540X, the tank. Kinda want you guys to have a small fight but considering that Blackhook won't be back here till wednesday, or so he said. So here's something else to keep you busy...]
Anarchy climbed the short stairs and saw a pedastal with strange markings carved into it. Inside its square shaped cavity was a small statue. It had an orb like head, with a single eye in the middle. A crouched down human shaped body, curled up in a fetal position. It had carvings of skinny and strangely shaped limbs, and a tail wrapped around what appeared to be it's legs.
Beside the pedastal was a cartoonish signpost with the words: 'Do not feed the head!' written on them. Though it appeared to be small enough to be picked up, it was actually part of the pedastal.
-
Anarchy looked in his pockets, he pulled out the small coin stocking gave him earlier. looking at it, he put it into the Statue's head...
-
The Protector now gave a warning shot to the nearing tresspassers via the bell hit by the shot. Now knowing they would be it's next meal. Gaia on the other hand, is rather furious that all he got was a tiny fragment teleported back from the ruins by his bomb squad.
*murmurs can be heard amongst the bomb squad*
Gaia: Ehh.. I don't know, just keep DIGGING!
-
Aside from the echoing sounds of a bell through out the ruins. Nothing seemed to had happened in Anarchy's current location...
-
Anarchy looked around, nothing happened.
Well, that was a joke, I better go back to the race.
Anarchy turned around and the door slammed in front of him.
Well, THAT isn't good. now I'm locked in this [tornado fang]ing room!
-
A loud cry can be heard in the room. As the protector slowly approaches it's next meal, it is also cautious. As intimidating as it sounds, THIS IS THE ROOM WHERE HE SLEEPS. AND BEYOND THAT THE EXIT. May not look like it, but this is the boss of this area.
(kgo, Just note I'm gonna be pulling several stunts with this guy.)
-
A small opening appeared in the room Anarchy was in, he took the coin out of the statue's head and pocketed it again. he then went into the opening.
It was bright, the room was a large circular path with no apparent supports holding it up, The Protector stood in the middle of it.
THE PROTECTOR
----------------------
Large Monstrosity of Unknown Alignment
I have to fight this thing? Tell me there are platforms on the back...
-
It yelled "THOU SHAL NOT PASS!", and made it's first move: by attacking with it's spearheaded tail. The tail itself was over about 10 heads tall, making the body 3x that of the tail itself. Massive, it's known weakness is unknown for now. Of course, any Lakitu present in this room would've been bones by now. A fitting end to a bunch of tresspassers.
-
Anarchy Dodged, contemplating the design.
My, that head is bulbous.... Looks almost like a Sphere... Wait, maybe...
Anarchy looked around, noticing some stones that looked easy enough to throw. He dodged another attack, and grabbed a rock. He waited till the head was in sight and tossed the rock. It stunned the beast.
Direct Hit!
Using this opportunity, Anarchy climbed up the creature, and prepped his Drill to severely damage the creature.
-
The creature regained postiure after a short while, and one-thousand eyes opened from it's back, side, and forearms, and emitted some kind of laser attack coming from nearly all directions. Unique about the stones around this area though, is that due to Gaia's reasearch, they seem to be impervious to nearly all kinds of laser attack. However, that does not keep from exploding.
BOOM! Rumbling can be heard from miles away, making the incoming racers more alert. This is the sound of a fight going on.
-
Anarchy tried to dodge the lasers, he then realized that he was wasting his time. He quickly grabbed a small chunk of rock, knowing that the lasers seemed to cause explosions, he figured that the explosion + rock= Propelling out of the cave.
He waited till the beast threw a laser towards the convenient skylight. And stood on the rock, luck have it he was propelled out of the ruins. Looking foward he could see the finish line in the distance. Seeing as he was in a rather out of the way location, he quickly looked around him. Sure enough, he found what looked like Token #2. He grabbed it.
If this one is a false again, I'll have to make sure to get a 3rd flag.
Anarchy dashed off the ceiling of the arena, shortly before it collapsed as the Protector smashed it down.
-
As the Protector's mindset telling it to "dont give chase, halt all offensive stradegies and wait for the next meal", it halted all vigorus activity.. for now, while bathing in the sunlight. Knowing it's body structure, it is resistant to all attacks from behind.. the ceiling collapse meant nothing to it more than an bite from a small mosquito.
-
Little did Anarchy know that he had stumbled upon a relic key to one of the paths of the ruins. Though not the token which he and all the other racers were looking for, it may have provided a clue towards its whereabouts. As the cloaked man landed back into the maze, the relic began to give a faint flash every few minutes.
-------------------------------------------------------------------------
"Hmmm, sounds like we have disturbed the resting place of some ancient beast...how predictably dull." Crimson muttered to himself.
"Do hope I find something to amuse myself soon."
-
Anarchy drove along, using the glowing thing as sort of a radar/compass, it started glowing brighter, so Anarchy took a right turn down a really dark tunnel.
Jeez, if it weren't for the light of this thing, I'd be blind.
Anarchy hit a wall at the end of the path.
Ouch, looks like this was a dead end... Oh look! Flag #3, how lucky of me.
Anarchy grabbed the flag, and as soon as he did that the thing glowed with intense light, Anarchy was engulfed by the light, when it dissipated, the object and Anarchy were nowhere to be found....
Where am I? Whats this music?
Anarchy looked around, He was in a large tube, lots of colorful spheres, bombs, and the occasional spring.
No... No... NO! Of all the places I feared going WHY DOES IT HAVE TO BE THIS?
Anarchy took a few steps foward, when he was done walking he found himself on the top of the tube and promptly fell.
Y'know what, this sucks. Where's the Forfeit button so I can return to the race?
[Don't worry, once I get done with being stuck in the Sonic Heroes Special Stage, I'll drop myself around where I was, except I'll be on the damn path again.]
-
[sa'right, as long as your being
tortured challanged it's a'ight. Now to think of something to write...]
-
[Challenged? Trust me, I'll be screaming before I get anywhere, I hate that damn special stage.]
Posted on: April 14, 2011, 06:27:17 PM
[Ok, I've had some rather disturbing thoughts. Time for a post!]
Anarchy revved his skates, he saw the Token flying past him, going at a set pace. He had to get to it before the end of the tube.
Lets Go!
Anarchy collected spheres, they slowly filled up his boost gauge. He occasionally ran into springs to be able to get shiny spheres, which further increased the gauge. He ran into the bombs constantly, though that was probably because his controller was a broken down piece of [parasitic bomb]. Naturally, with all of his frustration getting stuck on the ceiling didn't help much either.
COME ON! I'M ALMOST THERE!
Bombs....
More Bombs....
EVEN MORE BOMBS...
STUCK ON THE CEILING AGAIN.
"Progress Bar"
o-------=-----*-------o
= is Anarchy
* Is Token
o is the Endpoint
Anarchy saved his boost, making sure not to use it till he could get the token.
o----------=---*------o
Closer....
o-----------=--*------o
BOOST TIME!
Anarchy made a mad dash, using the conveniently placed springs to avoid the bombs.
o------------=-*------o
Anarchy extended his arm towards the token.
o-------------=*------o
He collected it!
STAGE CLEAR!......
Anarchy walked to the exit, but was impeded by yet another hole, a hole in an underwater tube? It was dark, mysterious, ominous.
Anarchy stood up, there was no visible ground, just purple haze, almost like Subspace but less defined.
Hello? Anybody here?
He looked around, nothing and nobody there. Then, he spotted somebody... it looked like Panty but Anarchy was unsure. He walked closer.
Panty? What are you doing in a dank place like this?
"Panty" turned around.
There was nothing, just a dark, shadowy figure, no discernable features on the body or face, just a black void of a shape.
Anarchy stepped back and started to run, but the shadowy figure had other plans, it materialized a gun out of its hand, it was blue at first, but then changed to a menacing dark red, it fired.
Anarchy was hit, right in the stomach, then he was fired at again, 5 more times, till he collapsed on the ground. It wasn't long before he tried standing up again, his armor was wrecked but he wasn't down for the count yet.
But that wasn't the end of it all, Another shadowy figure appeared, this one holding a sword. Without flinching it cut through the Wounded Anarchy multiple times. Another appeared, and another, and another. Anarchy was nothing more than a destroyed body now..... Then, a final shadowy figure emerged and stood over anarchy, the spectre went under a horrifying transformation, and assumed the Form of Anarchy, the only differences being a slightly darker color of clothing, darker hair, and eyes that shone in a crimson tone.
Anarchy woke up, he was alive, sitting back on the path in the God Complex Ruins, in his hand was the Token he had worked so hard to obtain, and also the 3 flags he had collected. Without a word he continued on the path, his eyes seeming to glow a bloody red. This, as you should've noticed, is Not Anarchy.
[Sorry bout this guys, I got a really odd thought in my head and I wanted to use it, Hurray for shitty plot twist!]
-
[Just think of it as a last hurrah from the Protector]
During the same time, the Protector had his filling of sanity, if anyone, or anything, wasn't devoured whole.
Protector *in thought*: RRR, dern whippershnappers..
-
A blue flash went by Anarchy. The confused racer then looked at his hands, the token and flags gone. In front of him was Hawk of the Spark 6, outside his vehicle holding Anarchy's missing items.
"It worked exactly as planned"
Anarchy focused on the sentai wannabe noticed too late that Hawks vehicle was right behind him. The car bumped into Anarchy in full speed, launching him into the air. Hawk jumped into the air and landed exactly on top the car's roof...
-----
Blackhook found his first flag, but he still felt uneasy...it wasn't because of the reaverbots or the traps, not even the other racers gave him that feeling.
"I should find the flags and get out of here...
-----
Adante didn't find any flags directly, but he encounterred two sparkvenian vehicles, each holding one flag. Adante didn't really care if they were sparkvenians. The msician pushed a button and then the two amplifiers on top of his vehicle started emitting a loud sound that flipped the other two cars over. The riders were unconsious when Adante approached them and took their hard found flags...
-----
Sachertorte has sneaked up to Clockston, Sally, ST and Crimson.
"Target found. Eliminate target"
The cyborgs arm turned into a bazooka that fired four homming missles at the group...
-----
Meanwhile on the Edeleisen.
Schimmer:"Miss Temnota? It looks like we've lost contact with one of the racers.The Turbo 540X from Sparkvenia"
Temnota:"Lost contact? You mean his badge got destroyed? That's not good..."
Schimmer:" It looks like it. The badges were created with link alchemy by Misstress Silan.If something happens to the owner than the badge reacts accordingly. It wouldn't be strange,if it was a normal racer that got lost in the ruins and his badge was destroyed by a rampaging Reaverbot. But this racer was one of Sparkvenia's newest combat robots. Also according to our reading, none other racer was aroundthe Turbo X540 during the time of it's dissappearance."
Temnota:"This is strange, what could have that much destructive force inside the complex?"
Stolz: "The Protector?"
Sieg: "No the protector was in a different part of the complex when the signal vanished...We should investigate it before this something can endanger the other racers."
Temnota:"We should inform Adante and Sil about it...And the other racers aswell!"
Sieg: "No, this has to be discrete. We don't want to cause any panic. We have to investigate, through in secret. I will go there...alone, the rest of you stay here."
Temnota: "But Sieg! You can't investigate alone!"
Sieg: "I won't. I'm going to contact the imigrants from the alternate RPM. They agreed to follow orders by Silan in a case of emergency..and this is one. Schimmer? Tell me their location, I'm going to meet them..."
After the knight got his information, he teleported inside the Godcomplex ruins to the location of Afroman and Chief Nalis...
-
(WTF Have I done? Restless spirits from the Protector's previous meals go unrest here. XD)
Now the protector has gone for a stroll, just to go to his favorite lake for drinking. This spells caution for the racers. Crossing paths with this beast will either have one's soul or mind devoured and left to become senile. This might have not been the best place for a race course.. AT ALL.
Did you know that before the race even began, a man unententionally fed this thing with a few Lakitus? Not filling, but residents of the Mushroom Kingdom will warrant a drink due to their salty taste, being exposed to a plumber's foot for so long.
-
(Let's just say the ruins are more than just ruins..nye-he-he-he-he-he-hwa-hwa-hwa-hwa!)
-
(No No No. What I went with was completely different, You'll find out later, its NOT the Protector. Anarchy is essentially gone, the Anarchy currently in the race is just using his body, but it is not really him. Just pure, unadulturated evil. Oh, and Evil is somehow more Mary-Sue than normal Anarchy.)
"Anarchy" caught himself in the sky and used his weight to pull himself down. He then landed behind the Spark 6's vehicle. Unwavering, he pulled out the powered buster and Shot the vehicle. And continued to shoot at it, his eyes getting darker in Red shade.
-
Hawk was unafected by the shots, since Anarchy wasn't aiming for him and the car wasn't getting damaged. While Hawk was getting further away, Anarchy was surrounded by the rest of the spark 6, all of them out of their cars.
-
The three (Crimson left the group to find someone) hooded racers were surprised by the sudden attack, but were able to evade the missiles accordingly.
Closkton used the loud ring of his Clock Scepter to detonate on of the upcoming projectiles. ST diverted the trajectory by using his one of his free capes, and Sally ate the remaining missiles. She promptly burped out some smoke.
"Oouuurrgh. I'm gonna get a stomach ache after this." She groaned in pain.
"Now Sally, you can't go and ruin your appetite like that, it's not even close to dinner time yet." The gentleman chuckled.
"Uurgh. Not funny, Clockston."
"Who are you and why should I care!" ST asked the attacker.
-------------------------------------------------------------------
"...Hmmm this is getting, dull, thought I would have found him by now." Crimson muttered to himself.
After a few more minutes of speeding through the maze, the man spotted a hovering boat.
"Hmmm...better him then no one I suppose." Crimson sped up to catch up to the windy pirate.
"Oi, second best! May I have a chat with you?" He shouted to the boat.
-------------------------------------------------------------------------
Meanwhile were Brocky was...
"...Huh...how'd I get back here again?" He grumbled, as he went to one of the paths that led back to the entrance of the maze for the 34th time.
Nekolyan however had managed to score 2 of the 3 flags required to receive the bonus points.
"Well this seems like my lucky day...strange though, I haven't seen or fought with many of the racers in the competition. I don't think they would fall for such weak and obvious traps either...I have a bad feeling about this..."
Suddenly, Nekolyan heard a bone chilling yet comical scream.
"YAAAAAAAAHAAAAAHAHAHAHAHA!!! (read like his crying and laughing)" It was B.C. who was dashing towards Nekolyan at the speed of a shot bullet, on his own two feet, holding on to his patched up car and one of the flags on his mouth.
"RUUUUNRUNRUNRUNRUNRUNRUNRUNRUNRUNRUNRUNRUNRUUUUUUN!!!" The man with the elegant body hair and styling clothes ran passed Nekolyan.
"...That can't be good..."
"AAAAAAHHHHH, MEDIC!!!" Shouted a red giant following the beautiful neandertal.
Nekolyan felt a dark pressence coming from the direction BC ran from. So as anyone with common sense would do, he swiftly pulled a U-turn with his bicycle, and ran away.
"Running, running, runningrunningrunningrunningRUNNINGRUNNINGRUNNING!!!"
-
"Anarchy" looked at the Remaining Spark 5, he quickly and effortlessly switched to splash mines. He disarmed them and started connecting them together, forming a large ball of Splash mines. He re-armed them and dropped it at his feet. The foreign entity controlling him then forced Anarchy's body to jump on the large ball, creating a rather sizeable explosion. It propelled Anarchy to catch up with the one named "Hawk". And left a smoldering crater at the site of the explosion. Damaging anything nearby.
-
The member called Slug..who is in fact a large slug, absorbed the blast, protecting his teammates from any harm.
Hawk wasn't surprised by the behavior of Anarchy. His car proptly fired some anti air missiles at Anarchy, who shouldn't be able to change his direction at the moment.
---------
Blackhook looked at the man behind him. Clearly he was not a Sparkvenian, but the pirate had to be careful.
"Yes my good sir? How can I be of any hellp to you?"
-
[I'm going to call Evil Anarchy "Not Anarchy" from now on, seeing as he is not really Anarchy.]
"Not Anarchy" switched to the Machine Buster. He shot down a few of the missiles and dodged a few others, one of them hit him in the right arm.
Seeing the last missile, "Not Anarchy" moved to the side and grabbed it by the fin, using its propulsion he gave himself enough momentum to fling the missile back at the damned bird-person.
"Not Anarchy" then grabbed at the vehicle, he was not undamaged, his right arm, where the missile hit him, had skin coming off...
Underneath was the pure black substance that had taken Anarchy's Form.
Meanwhile....
On the outskirts of town, a small pile of snow appeared to move....
It was a person, a person who had the appearance of a certain rouge racer, but none of his color, completely white with black outines, he looked like he was from a Manga.
It was Anarchy, still critically injured from his mutilation by the mysterious shadows. He got up, and was unable to walk, he slowly limped around, trying to find help...
-
Gaia, still outside, was waiting for at least ONE racer to come out of the damned ruins. He turns around and asks the person next to him.
Gaia: What the hell is going on in there? It's been nearly a full day and no racer has resurfaced yet, and yet I hear a loud roar coming from the Protector. What the [tornado fang] are they doing?!
-
Hawk looked at the wound with confusion.
"I thought he was human?"
Suddenly Not Anarchy got captured by a whip. It was Gecko's whip, and while the SPark 6's leader was holding him, Ox rammed Not Anarchy with the horns on her helmet. The other 3 were in their cars, backing the rest up.
-
"I wish to have a chat with you, is all." Crimson told the pirate.
-
Another two wounds in "Not Anarchy", the darkness seeped out from the disguise, "Not Anarchy" laughed. It was odd sounding, the voice was off, probably why it had avoided saying anything.
It grabbed the whip, and yanked it to pull Gecko from his spot. He then grabbed the horns on Ox's helmet and broke them. "Not Anarchy" Grinned, his teeth were jagged, another red flag to his wrecked disguise.
Posted on: April 16, 2011, 03:51:00 PM
The real Anarchy kept walking towards the stadium. He needed medical attention, badly. He could hear voices in the stadium as he approached the doorway.
Meanwhile, the screens in the Stadium show "Not Anarchy" in the race, people muttering and wondering why the person they believe to be Anarchy is a being of pure darkness under a human disguise.
I knew that guy was freaky, but HOLY [parasitic bomb]. Is he like a ghost or something? Sure would explain why you like him so much...
Thats not him... it can't be, his eyes, they aren't red. That.... thing must be a doppelganger. We've handled these before, lets go kill it!
Wait... Stop.
Huh? Anarchy? Is that the real you? Where are you?
Down here... hurry....
Stocking looked down at the entrance, Anarchy, still completely white, sat there, kneeling from the painful wounds.
Are you really Anarchy? You don't seem to look like him.
That [tornado fang]er... out there... he stole my color, my weapons, my identity, soon he will start corrupting the people who come into contact with him... he is pure evil, dressed like me. His weapons will soon reflect that, his appearance is doing so already.
Yeah, we can tell... He looks like a ghost.
Anarchy grabbed at Stocking's dress with his wounded hand.
Please... you have to take me to a hospital... I'm not much longer for this world if I don't get any medical attention.
Alright, one second Anarchy... PANTY! EMERGENCY, GET YOUR ASS DOWN HERE SO WE CAN TAKE HIM TO THE HOSPITAL!
Fine, Fine, one second... Let me just find the damn keys.
Chuck Chuck Chuck...
You bastard! Give me those damn keys!
Thanks... I owe you one... Stocking.
You don't owe me unless you die. I'll never forgive you if that happens, you promised to take me to that fancy sweets cafe and you've yet to do so, remember?
Why would I forget?
LETS GO!
The three got into See-Through and left for the closest hospital.
-
Temnota was annoyed by another intrusion in the race.
"I wonder if there is a connection between this being and whatever was responsible for the dissappearance of Turbo X540..I'm going in!"
With that Temnota stepped into the teleporter of the Edeleisen and got transported into the Godcomplex ruins to the location of Not Anarchy.
"Members of Spark 6..please leave!"
The sentai heroes after aknowledging the second in command of Sparkvenia left in their vehicles. Not Temnota was facing Not Anarchy alone.
"Identify yourself please!"
----
Blackhook's ship stopped.
"A chat? Is it something important?"
-
"Not Anarchy" looked at the woman.
Me? I can tell you can see through my disguise. No sense in keeping a wrecked skin anyway.
Body horror ensued as "Not Anarchy" grabbed at its face, slowly peeling off the disguise. Within a flash the Shadowy figure stood before the Woman. Red eyes had formed from the blankness, along with a sharp, toothy grin. Its hands were pointed at the fingertips, skin a blackish red mess.
I am Noi Id. I came from the alternate realm accessed by that Fool calling himself Anarchy, I used the opportunity of having a being from the other side to entrap him and slaughter his body, using his form I was able to come to this world. Now, It is time to destroy it, and everything that exists inside! The boy that I used so gracefully for my escape is either dead or close to death. If you think you can stop me go right ahead, just be warned that you life is at stake, and you WILL fail.
-
Temnota wasn't impressed by the body horror or Noi Id's introduction.
"So..you are neither a racer nor a judge and you are clearly interferring with this race. I have to ask you to return to where you came from..othervise you are forcing me to take drastic measures."
Temnota's eyes showed determination. She took a fighting stance before introducing herself.
"I am Temnota, zivel of Darkness, Prime minister of Sparkvenia and Head judge of the great Rpm race!"
-
Gaia noticed a pink hummer heading somewhat eastbound. He starts to pursue the vehicle with his X3-005 Aerial Combat Armor he recently activated.
Gaia: Dammit Anarchy, what the hell did you do?!
------------------------------------------------------------
3-005 Aerial Combat Armor Summary:
360+ Horsepower jet engine locaited in backpack. Long, sharp wings resembling those of a hawk are also locaited at the sides of the backpack; equipped with their own ventilation system to keep the backpack from overheating in-flight.
Weapons in this armor inculdes two pairs of beam katanas, both of which can be linked up to become a beam-staff. The other weapons with the exception of the gatling buster is disabled, and cannot be switched out. However, there is an highly experimental laser cannon equipped, but like a superweapon's cannon blast, it must be recharged for 24 hours. Overuse will cause backfire upon the user.
The "horn" will grow a spike, causing it to resemble a rhinoceros beetle horn. Two extra wings sprout from the legs, but shorter to maintain balance during flight.
-
Noi Smirked.
You think that matters to me? You can try to hurt me, but as you've seen from my little introduction its rather difficult to injure me. I got hit by a missile to the arm and all it did was damage my disguise, do you really think you can hit me harder than a missile could? Lets just see you try.
-
"I have to dissapoint you...but I don't have the power of a missle."
Answered the whitehair honestly.
"But you've ignored one fact in my introduction. I am the zivel of darkness. Do you know what a zivel is?"
-
Seeing as its something I've never heard of how could I possibly know what it is?
Noi Remarked.
Meanwhile....
See-Through is at the Hospital (After vast amounts of property damage caused by reckless driving.) The sisters carry Anarchy in.
This man needs to be treated right away!
There will be a short wait... there are other people waiting to be treated too.
IF HE WAITS HE WILL DIE, JUST LET US THROUGH SO WE DON'T HAVE TO CARRY AROUND A CORPSE!
Alright, fine, fine.
A stretcher comes out of the nearby doors. The two drop Anarchy onto it, a Team of Sameface Doctors rush out and take the stretcher, the Sisters following behind.
-
"Well, Sil explained to me once that having powers over a natural element isn't that rare in this world...though there exists a group of people that are more than that. When you are born a zivel you can control a element of nature like it would be a part of you because a zivel is basically the human manifestation of Nature."
Temnota rolled up her right sleeve and revealed a tattoo on her forarm which resembled a sun except with invards pointing rays.
"I am the zivel of Darkness...in other words..."
Noi noticed that he is unable to move.
-
Suddenly, the Protector noticed a stream of darkness. It angerly roars and charges towards the source.
-
Ergh...I see, intresting trick you have there.
Meanwhile....
Anarchy was tossed into a statsis tube, his injuries couldn't be handled very well with normal medical treatment. He was to awaken from his statsis in a matter of 3 hours.
-
Gaia then reached the hospital, and found the pink hummer in the parking lot. He soon switches his armor out for his more well-known appearance, before entering inside the complex.
-
Anarchy floated in the liquid inside the Statsis tube. His injuries slowly healing, the Anarchy sisters waited paitently. As much as it said 3 hours, that probably means 30+ Episodes.
NEXT TIME ON RPM:
Anarchy is still in the Tube, more staring, more signs of a battle about to go down... that doesn't go down, DON'T MISS IT. [ 8D]
-
"My deepest appologises, but I cannot allow you to cause any more bad"
Said Temnota and suddenly everything around her and Noi became dark...not even allowing the audience to see the outcome of the fight.Minutes later the lights returned and only Temnota was standing there.
/"Was that being a creation of this ruins? I wonder if Sieg can find out something...this place is creepy, the racers should leave it as soon as possible..."/
----
Meanwhile the Spark 6 was nearring the exit, Hawk still carrying the 3 flags and the special trinket.
Adante was still looking for a third flag.
-----
Pfeferkuchen turned his arm into a machine gun and started firing at Clockston, ST and Sally.
----
Troll Rex and some Otokojuku students were wandering the ruins..they somehow managed to get hol of 1 flag which was being held by Waddle Dee
(Calling Afro! Or anyone really...)
-
[Aww. I wanted to have Noi merge with something. Oh well.]
Anarchy, still in the tube. For an approximated 3 hours it sure is taking a lot longer. Panty started to get frustrated and kicked the Statsis tube, only to be led outside by medical professionals. Stocking was eating the Hospital sweets, and found their quality to be rather shitty. Chuck and Garterbelt were somewhere else, being non-vital to the story and quickly becoming forgotten side-characters, just like that mysterious voice from the Second segment of our friends story, what happened to the mysterious housekeeper anyway? I guess this look back on memories is sort of Anarchy's thoughts... I don't really care since I'm just a damn narrator, they could have any idiot take this job! Nah, I think I'll stay around.
[Stretching this out like a poor quality rubber band.]
-
Gaia soon reaches the stasis tube anarchy is in. He thinks he has an idea..
Gaia: Let's see if I can speed up the healing process... *injects some healing nanomachines into the liquid tube connecting to Anarchy's body, with all the nanomachines flowing into him, and making super-speedy recovery times possible*
-
"Depends" Crimson grabbed on to the side of his car and stretched it into a gelatinous material. He threw the long stream of red jelly at the boat's deck, making a small bridge between the two vessels. He slowly and calmly walked towards the captain.
"I wish to test you first, second best". The white masked and elegantly cloaked man stretched his arm and grew out a stave.
"Understand?"
-----------------------------------------------------------------------------------------------------
ST quickly formed a shield with the same cape he used to deflect the missile. Sally transformed herself into an iron maiden and protected Clockston.
"Not a very chatty guy is he?" ST told his companions
"Quite rude to be exact. Hmph!"
"Ow! Hurry and beat this guy up Clockston, I can only keep this form for a little bit." Sally tried to bare the stinging pain of the bullets on her hardened skin.
ST shot at Sachertote with his cape buster, while Clockston quickly turned and tried to pass by the side of the horse riding cyborg.
[Can you guys remind me how many flags have been captured? This are the ones I remember at the moment:
Cervantez Jalapeño Sr. - 2 flags
Spark 6 - 3 flags and token (stolen from Anarchy)
Nekolyan - 2 flags
Bishounen Caveman - 1 flag]
-
[Alrighty, with the "Not Anarchy" thing over, and Anarchy nowhere to be found on the racetrack, I can assume he is disqualified? And Gaia, no trying to speed up the healing process, it takes at least two weeks of watching at 4:30 every monday-friday. ;) I'll have Anarchy come back later, but for now I'm going to take a small break, I'm getting some nasty writer's block and I feel ill. I'll probably be fine tomorrow.]
-
(by recovery speed boost I meant around 25% recovery rates go up, Gaia's usually the guy with experimental tech from his homeworld.)
-
[Yeah, but I don't wanna come back yet. I need time to feel better so I can actually write decently.]
-
(Ya do your own thing then, looks like the Protector's gonna have to steal the spotlight again until the time comes.)
-
[Y'know, I wanted Noi Id to merge with the protector and have [parasitic bomb] go down big time, like, Sonic 06 bad, [tornado fang]ing colors inverting, slowdown, space time voids ripping apart, [parasitic bomb] would've been awesome, but whatever. What we have going on is fine too.]
-
(Good thing I stopped that. :D anyways ST:
Blackhook and Sachertorte - 1 flag
Adante-2 flags
Otokojuku students-1 flag)
"YOu want to test me?...and why are you calling me second best?"
Asked Blackhook.
-
[Very funny. Anywho, still sick, going to keep Anarchy stewing in the tube for a while, by the time I get better he might be golden brown. Boy do I love endless "wait till the guy gets better" time periods. [/sarcasm]
-
[@Blackhook: Ah so 3 flags left then. Thank you Blackhook.
@Anarchy: In well, you might not be disqualified. Though considering Noi had stolen your gear and Temnota has supposedly annihilated the ghost, along with the remains of the armor, and of course the whole being literally booted out of the race seems pretty clear that your character should be disqualified.
But only 2 active members playing as the main racers (Gaia seems to mostly play a secondary/assisting roles, and we haven't heard from White-Jet since the first race started. Afro also rarely logs on but that's mostly due to some IRL situations) seems a tad bit boring if you ask me. Not enough random shenanigans happening.
Course if Gaia is willing to be some of the hazards, such as the Protector for the rest of the arc. This should keep things fresh for this arc. Course Gaia, I wouldn't mind if you made up a random racer to keep this thing active, there are still around 500+ racers left in the game. Anyone else reading this who is interested in joining in may do the same if they wish.]
"...You are right, you are not second best...third best then?" Crimson said jokingly as he prepared to duel.
-
(since a vast majority of the racers will be out of action, be it disqualified, killed, or simply vanished in terms of being devoured hole by some unholy beast I unleashed, I can say this arc might end up with an Racer-X persona. Of course, that will take me a while to put together a character, with his background, age, history, and whatnot included.
I might continue controlling some of the obsticals, since Gaia too will be out of action for awhile, still trying to apply explosive material found on anarchy into his highly experimental laser cannon, along with trying to help out the docs make a superior healing device than what they've got.. We'll see.)
-
[I'll probably have my gear get redesigns, with everything getting some sort of nice enhancements. That is once I start feeling better to write silly fiction again. :)]
-
"WHAAAT!? MORE THAN ROA!? O:< Please, this isn't even making half of what Roa Knows Best! >8| The only reason this is making more money is because of the Underground deals...I miss Roa Knows Best. O:< <(this is his sad face too)
"Sigh, true. The ratings haven't been the same since we hired that replacement. However, that is beside the point.
(....................*brohugs ST* ;O; )
Troll Rex and some Otokojuku students were wandering the ruins..they somehow managed to get hol of 1 flag which was being held by Waddle Dee
(Calling Afro! Or anyone really...)
(Damn....i hate irl thing getting in the way. >_> )
Dee was holding now the school flag and another flag that bounced atop rex's head as hetossed a random racer over his head.
Agent Js current status - blasting and running over cannon fodder reaverbots somewhere.
Afro-man and A.Silan/aka Chief current status- currently making their way to the 'assumed from thier p.o.v.' the exit and possible finish line.
Afro current status - SO [tornado fang]ing LOST! Travling up a spiraling tower, and is totaly not lost...really! O3O
-
BH raised an eyebrow.
"Well, since we are technically still inside a vehicle, I guess we are allowed to fight. Though, I wonder what your intentions are..."
The captain took a battle stance, the wind arounfd the two blew stronger.
-
Anarchy, now just frustrated at Gaia, busted out of his uncomfortable statsis tank.
Stop, Please! I'm fine now, though I appear to still be dying.
Anarchy looked at himself, his color was mostly back, but when he moved it faded, his Color was, in essence, his life force.
You're awake! I thought you were going to take longer, I ordered a truck full of Creampuffs but now it seems they'll have to go to waste.
No, we can stick around a little longer, I'm not entirely ready to go anyway. We can share them, ok?
Ehh... I've been stuck eating this terrible hospital food all day and you want half of the creampuffs?
I never said that...Well screw that I'm ordering another truck full..
Wait! You don't have to....Done!
*Sigh* -AC
Stocking looked at Anarchy, she didn't seem to notice anything off about him and gave him a hug, she could then feel that his entire body felt.... weak.
Hey... Are you alright?
Anarchy was breathing heavily, his color faded again. Stocking looked at him in shock.
This... why is this happening to me?
Anarchy fell to his knees, trying to regain his health... He then came to a realization....
It was when I was there.... the place where Id came from...
Id? Who's that?
The being who became my imposter during the race... He wasn't destroyed... He took my gear... My weapons... My good luck charm... It seems he took a fraction of my life force as well. It seems... that any physical contact with you injures me... did he implant a shadowy essence into me? I need to go back to that place... and destroy him... If I don't... then It'll be the end of me.
That can't happen! We have to go, right away!
Stocking used Gaia to haul Anarchy onto a Stretcher and haul him to See-Through, where Panty was waiting.
Oh hey, it looks like hes ok... why is he on a stretcher?
I'll explain on the way, we need to go to the God Complex Ruins!
Where the race is? Why do we need to go there?
I SAID I WOULD EXPLAIN ON THE WAY! STEP ON IT YOU DUMB [sonic slicer]!
The trio drove off to the ruins. Anarchy said a few things before passing out.
You need this...
Anarchy handed the mysterious key over to the Sisters, he managed to hold onto it, for no apparent reason.
Whats this for?
Its how I got in, it should activate once we get to the ruins...
One last thing...
Whats that? You noticed we forgot the creampuffs?
No, I think... if I make it out of this mess alive... I'll just call myself RMZX "Anarchy"... it fits better for me... that way I can just use my old name again.
Oh, I liked your old name better anyways.
-
"You will find out soon enough. Just do try to keep up, third best." The masked man's stave stretched out to the side and arched its way towards Blackhook. All in a swift, almost unseen, motion.
-
The trio approached the ruins, noticing that despite the large amount of cameras and attention paid to the race, they never bothered to spring for security, so they drove right on in like it was a tourist attraction.
This place is... well, certaintly better looking than the TV's made it out to be.
I'll say, its a lot more boring in person.
The key started to glow again. In a short while the Trio were teleported into the vast unknown where Id was supposedly hiding, restoring himself using the life force stolen from Anarchy.
Good Lord! Its [tornado fang]ing dark here, I wouldn't want to be stuck here, no siree.
The whole area smells of ghost.
Anarchy woke up... he was in disbelief that he was back here, where he was almost killed.
Be quiet!
....
You hear that?
Power....Need More...POWER....I feel it....nearby.
That scent, oho, its that boy again....
another scent... it smells like [sonic slicer], oh this will be enjoyable...
Another? It smells like....sugar?
No matter, another two forms to steal and I'll have my ticket to vaporizing that pathetic existance on the other side...
Its Id...he's going to try and kill us... Keep your guard up!
-
(So uh, is this race still going? )
-
(Yes)
-
[We have lots of side crap going on, mainly on my side, probably because I wanted to mix things up a bit while still participating in this RP.]
-
(Ah. ok. Carry on~)
-
(You can join in...really, please join)
-
(Plus I'm controlling nearly all this [parasitic bomb] going on in the ruins it's not even funny, now that Gaia's inside the ruins himself. Yeesh)
-
[Yeah, Flame. You don't even have to race, just do some side stuff.
Y'know, I miss the old group. Alice/Lucky Star is gone, DWII doesn't RP anymore, same with Akamaru, Archer/Roa/Laura just got sick of it, and now even Flame is never here. Its just down to Me, Blackhook, Gaia, ST and the occasional Afro-Shroom (Did I forget anybody?). You must admit it can start to get... stale. Not to mention RPMVania is constantly overshadowing us with its... whatever it is that it has that makes it more intresting. :\]
-
(Im here. Its just im more occupied with the RPMvania RP for the moment. its nearing the climax and i just cant figure out what to write. (slight creativity block))
*Flame sips tea in his space station*
-
[So yeah, I've been thinking guys, should we shorten this race to maybe 5 tracks instead of 9. I'm thinking this arc might be taking longer than I expected.]
-
[Yeah, this current one is kinda dragging on, if I do decide to have my character back into the races I'm really going to get sick of typing "Anarchy Revved his jetskates" one million times. Hell, we should think of ideas for the next track, we did basic streets and ruins, lets do mechanical area next, then a tropical area, and finish it off in some space kinda thing. :P]
-
(I doubt Rainbow Road hasn't made an appearance yet, so why not let that be the last course?)
-
(now you see why i decided not to participate. RPs are things that are meant to last a while. Something like a race would go on TOO long.)
-
[Ah, personally I think a race is difficult because it requires many people doing lots of things while moving. Since we have only 4-5 people at any given time, 2 of whom are not on as often as the others, it goes a lot slower than intended, which is probably why I removed my character from the race.]
-
(Hmmm. We haven't destroyed RPM in a while. We should have a big arc again. I mean jesus, the Roa arc tops all, but we should have another one on that magnitude.
ANYONE UP FOR ANOTHER COLONY DROP? 8D )
-
(Working on it...:D)
Ritter Sieg was walking carefully trough the halls where the got the last signs of Turbo. He came across a wall with inscriptions on it in a language unknown to the knight. He came closer when suddenly a huge black hand emerged from the wall. It was about to grab the night and squash him dead, though Sieg didn't even flinch. Within a blink of an eye, the demonic hand was cut into tiny little pieces. The pieces fell to the ground and vanished in a stream of smoke.
"What are these glyphs? I can't decipher them...I really didn't want her to be botherred with this but I guess I have no choice."
The knight sighed and called his boss...
In the Stadium.
Silan was sitting in the royal lougue when she got the message from Sieg, who told her about the situation.
"It may detract from the race, but I am quite curious about this...send me a picture of the wall."
The misstress put on her Glasses of insight - oversized glasses that worked, pretty much like a computer though someone simple minded cannot wear them for longer than a minute (The results were quite nasty...).
In a few minutes Silan had decoded the inscriptions.
"Sieg, it's pretty much a warning. Some parts were hard to translate so I'll tell you the short version: IF a master of disaster enters the chamber of God complex and the key is also nearby, the it shall awaken... and return to it's original form? We, the people of... I couldn't translate this part...cannot allow it to happen. Leave this place at once or ....."
Silan put down the glasses.
"It seems like on of those old temple curses...I guess we have nothing to worry. There is no master of disaster or anything like that in the ruin. But just in case when all the flags have left the ruin, we will teleport out the rest."
Sieg satisfied with the answer was about to teleport out when he remembered someone.
"Meh...not even he would cause something like that.."
(Basically the ruins are something more than ruins and to solve the mystery, a key and master of disaster are needen so....Calling Afro-shroom! 8D)
Blackhook didn't move an inch when he got attacked. When the stave came close enouggh, it got simply blown back by BH's wind shield.
"You wanna test me? Well, then I guess we don't have much time to play around then. How about you became more serious?"
-
(We need to get Wily back for this RP. its no fun without our resident mad scientist)
-
[@Blackhook: I take the fact that you have yet to make your character perform an action means that he wants to get hit?]
Failing to react quickly enough, Blackhook was stabbed in the neck by Crimson's stave. Hitting a vital artery, the unwatchful captain began to bleed to death. Plasma was sprayed all over the deck and at the shocked crew men that had joined the amnesiac pirate to this ruin adventure.
Poor Blackhook, we hardly knew ye.
Ye are dead, cap'n
Dead!!
"Well that was a disappointment. *snort*" Muttered the intruder.
[Continue?]
------------------------------------------------------------------------------
Racers were already nearing the exit of the current track. The Spark 6 held 3 flags and the token in their hands. Cervantez Jalapeño Sr. also possesed 3 flags in his hand. Meanwhile, Nekolyan, B.C. and a Heavy stumbled upon one of the four Judge knights.
-
....Huh?
(Working on it...:D)
Blackhook didn't move an inch when he got attacked. When the stave came close enouggh, it got simply blown back by BH's wind shield.
"You wanna test me? Well, then I guess we don't have much time to play around then. How about you became more serious?"
-
[...I was pretty sure that wasn't there when I read your post. *looks at you suspiciously* But very well, it was a joke post anyway. Sadly I couldn't find a good video for the YES command on the continue screen I wanted to make so I couldn't post it in my last post.]
"Gladly."
The shield caused the stave to splatter some gunk around the deck. The gunk that was above the pirate quickly fell back towards him as small hardened spikes. Crimon retracted his stave and dashed towards Blackhook, spinning his weapon while he got closer to his oponent.
-
(Working on it...:D)
Ritter Sieg was walking carefully trough the halls where the got the last signs of Turbo. He came across a wall with inscriptions on it in a language unknown to the knight. He came closer when suddenly a huge black hand emerged from the wall. It was about to grab the night and squash him dead, though Sieg didn't even flinch. Within a blink of an eye, the demonic hand was cut into tiny little pieces. The pieces fell to the ground and vanished in a stream of smoke.
"What are these glyphs? I can't decipher them...I really didn't want her to be botherred with this but I guess I have no choice."
The knight sighed and called his boss...
In the Stadium.
Silan was sitting in the royal lougue when she got the message from Sieg, who told her about the situation.
"It may detract from the race, but I am quite curious about this...send me a picture of the wall."
The misstress put on her Glasses of insight - oversized glasses that worked, pretty much like a computer though someone simple minded cannot wear them for longer than a minute (The results were quite nasty...).
In a few minutes Silan had decoded the inscriptions.
"Sieg, it's pretty much a warning. Some parts were hard to translate so I'll tell you the short version: IF a master of disaster enters the chamber of God complex and the key is also nearby, the it shall awaken... and return to it's original form? We, the people of... I couldn't translate this part...cannot allow it to happen. Leave this place at once or ....."
Silan put down the glasses.
"It seems like on of those old temple curses...I guess we have nothing to worry. There is no master of disaster or anything like that in the ruin. But just in case when all the flags have left the ruin, we will teleport out the rest."
Sieg satisfied with the answer was about to teleport out when he remembered someone.
"Meh...not even he would cause something like that.."
(Basically the ruins are something more than ruins and to solve the mystery, a key and master of disaster are needen so....Calling Afro-shroom! 8D)
(o3o)
Afro-Shroom was basically cruise up the seemingly endless tower,"Fffffff- Ill be in dead last again cause of this-AGH!" he was cut off when he crashed into a large door at the top of the impending tower. "Huh? Whats this?" He asked getting out the cart and walked up to what seemed like a large crypt. He blinked and looked around, not noticing he had accidently picked up a flag and it was now securely jammed in the underside of his cart, and poked the seemingly solid stone door. "Hm....I guess if im gonna be dead last i might as well do something while I wait for the race to finish~" he said looking around to see if there was a switch or hidden entrance, cause in the movies there was always something like that right?
-
Captain BH tangled the spikes with his longcoat (Which he was totally wearing, since, he's a captain and all) and threw them at Crimson, while creating a small tornado around his hooked hand.
---
Sieg noticed the approaching racers. He had to stop them and convince them to choose a different path. Suddenly he got a message...
"That afroed...grr, I'd better get to him before...oh, I can't allow those racers to come here..well, I guess I'll take care of them first..I mean, what can possibly the afroed man do?"
Sieg then stood in front of the cars.
"HALT!"
-
Afro kept pokeing at a spot on the stone door,"Poke poke poke pokedy pokepokepoke~" *^3^* he sung to himself, the spot soon formed hairline cracks from all the poking. "Eh?" He blinked and stared at it before poking it one more time, sudenly huge cracks formed and spred all along the stone wall,"..." -u-;
-
Before the spikes had even scratched crimson, the spikes had soften and merely smeared the jelly man's body. Crimson continued to spin his stave, releasing and splattering gunk around the whole deck. When the masked man had the pirate in his range, he attempted to knock him off his feet with a strong left swing of his weapon.
---------------------------------------------------------------------
"LIKE HELL WE WILL!!" The panicked duo shouted, running past the all shining knight.
"IT OUTSMART BULLET!!" The Heavy cried as he too rushed by Sieg.
A lowly scout popped out from the ear of the heavy, sharing a bit of folksy wisdom to the knight before disappearing back into the empty head of Heavy.
"Knock if ya bonk-bonk~! BONK BONK~!."
The shadows crept closer to the 4 individuals.
-
[Yeah, I'm going to take another break. Since this RP is pretty quiet anyway it won't really be noticable, if anybody *really* wants to they can take care of my characters. I'll be back once I'm finished with school on May 25th.]
-
Sieg sweatdropped as the racers passed him.
"Meh, less loons to annoy me in this world...gah, I am not allowed to slack off!"
The knight followed the group of racers.
Blackhook blocked the weapon with his hook. The wind surrounding it acted as a saw and cut the weapon in several pieces.
The captain looked around and noticed the gunk all over his small boat. He remeberred the smikes from earlier and concluded the man's ability.
"Just a little warning. Whatever you are planning on doing with that blob ability of yours make sure not to damage this ship. I hope that you are an understanding gentleman."
The pirate pointed his right hand at the masked man and released a strong wind blast.
The wall cracked completely and fall to pieces, revealing a secret room behind it. The room looked like some sort of laboratory, though not like any run of the mill lab. It looked like something from ancient days. In the middle of the room was a stone capsule which opened the moment Afro set foot into the room.
From inside it emerged a female humanoid pale android,in silver armor pieces with strange emblems on it. The android looked pretty for human standarts, round head with purple dreadlocks with the face and body of a young woman.
The android opened its eyes. After blinking a few times it looked around and after noticing Afro, walked slowly over to him. It stopped in front of him and kept looking into his eyes.
-
Crimson released a net of glob from his wrists at the deck, preventing him from being blown away by Blackhook's gust.
"You won't need to worry about that. I understand the joys of having a fine vessel such as this. Though, I should say that you might need to watch your next move."
The messy gunk that covered the deck had disappeared from the pirate's sight.
"Do plan your next move carefully...check."
-
((So... wat do?))
-
[Good question. Can anyone propose a good way to start the next half of the arc on Flame's side of the story (I'm assuming the actual race event will be cut off short before or around the time the second track has been finished due to some otherworldly phenomena) Or rather can you feel me in on what's about to happen, through PM of course, so Flame (and hopefully others) can continue to participate in this RP.]
-
(Basically, Afro has unleashed a doomsday device so, I guess that may spark your interest? Also there is a conspiration going on in the race oh and Sparkvenia is trying to take over RPM? Oh and there is also Afro's 'alternate dimension threat' plot)
Meanwhile the Spark 6 (Who even though are a group of six are counted as one racer) have left the ruins and are headed for the finish line. Following them is Adante and some Sparkvenian cars that followed them (even though they have no flags)
"Hmmmm....just one more question? Do you breathe air?"
Asked BH his opponent.
-
"Just like any other land creature, my friend. Though if you're planning to do either of the things with your air manipulating powers you would do in this situation, I am happy to tell you I have already taken the precautions for such a move...check." He told the pirate, confident of his own tactical abilities.
"I'll give you 10 more seconds to come up with a move to defeat me. Do try to impress me, Third Best." Crimson told him, in an arrogant tone. Though his eyes were ever vigilant on the wind captain and his surroundings.
-
"Oh well, then I'll show you something else"
BH concentrated for a few seconds and then released a huge amount of energy from his body. It didn't seem like it has affected Crimson. But suddenly the stone pilars and even the floor started grumbling and falling appart. While that happened their vehicles sunk into the ground a bit.
"I can't remember why I have a hook for a hand or why I have this powers. But I assume you that I have full control over the air and wind and I bet that you are smart enough to know what wind is capable of. Is that enough for you or are you still seeking for more?"
-
"...Very well, you seem confident enough. Glad to see you can use your powers effectively as well." He said, almost gladly.
"Of course I am a bit disappointed you didn't try to defeat me...then again, if a snake already has his fangs on the mouse, there really isn't much he can do to escape, is there?"
A medium sized gunk of slime had latched itself on Blackhook's back, it was pointing a sharp spike at his spine. Made from some of the collected slime of messy deck, as well as the previously shattered stave that had gotten on pirate's cloth.
"Let's see, you avoided walking from the fairly obvious needle trap. You can use ranged attacks without needing to move an inch of your body Though you could use a bit of work with your calculations..." He said, as if he evaluated the pirate's performance.
"But, I'll take what I can get." All the slime on the ship had melted and slid their way to the masked man's body.
"I am glad that I didn't have to use my vehicle as another precaution, of course it wouldn't have been as swift and effective as the rest of the traps." He said, chuckling lightly. Drew close to Blackhook and extended his hand.
"They call me General Crimson, of course I'll let you call me Jeffrey, just this once though".
-
The captain shook Crimson's hand.
"As I said, I don't remember my name, but people call me Blackhook. So, what was this all about?"
-
"Test of your abilities of course, Cap'n Blackhook." He said in a calm tone.
"I can't trust to give this information to just any run of the mill racer...but before that..." Crimson collapsed on the floor.
"You wouldn't happen to have a barrel of water, would you?...Keeping my vehicle solidified and making the plasma for this fight seems to have taken a lot out of me."
-
"Well, I happen to have a bottle with me, though it's surprising you don't have water with you..."
BH handed him over a bottle he had with himself.
"Well, I guess we should head out..."
Sachertorte ceased his attack on the group and decided to have more fun with them in the next round and so he sprinted away on Pfeferkuchen.
-
[Y'know what? I lied, I'm going to have another crack at this. And furthermore, I'm going back to calling Anarchy RMZX.]
RMZX Looked up.
This was a bad idea.
No it wasn't, stop your whining and get ready to fight.
DO I LOOK LIKE I HAVE ANY WEAPONS?
Keep your voices down, he might hear us.
I already did, foolish angels.
The two turned around in shock, Id was standing there holding RMZX in a chokehold. The peculiar appearance of Id had them believing that he was somebody he might very well be.
CORSET! YOU CAN'T FOOL ME WITH THAT DISGUISE!
What do you want with him?
Corset? You must have me confused with somebody else... But If I really led you down that path that would be rather unfoward of me now wouldn't it?
Corset shed his shadowy disguise, revealing the disgusting grey features coupled with belts upon belts tightly wrapped around him. The two Angels gritted their teeth.
What I want with the boy is simple, his little dimensional drive is all I need to spread the fires of hell across the entire multiverse, you see, having just your heaven wasn't enough, having the entirety of your world wasn't enough. When this boy used that key it opened a small window of opportunity for me to escape through to this side, now that I have the original dimensional drive, all I have to do is tweak it a small bit and the world will be ready to be completely devoured!
You have what you wanted, so what are you even going to do with him?
Tsk, Tsk, I'm going to Kill him. Then I'm going to do the same thing I did with you and have a duplicate take his place. You got lucky and were spared having to die, allowing you to eliminate your copy. This one, on the other hand, won't have that same pleasure!
Let... GO OF ME!
You think that's really going to help you? KEKEKEKE!!! FOOLISH CHILD! I'M A BONDAGE MASTER, YOU AREN'T EVER GETTING OUT OF MY HOLD!
RMZX's face turned red, his entire body being crushed by the belts.
...elp....e......oking...
RMZX passed out from loss of breath.
Corset left, taking RMZX with him.
BEGONE, ANGELS!
The two and their car were transported back to reality.
Great, now we have to save weakling.
... Where do you think he's going?...
Not a clue... We're going to need help. Get started on that, Stocking.
....
Stocking? You hear me? Move your lazy ass and get started.
You do it....
Stocking walked off.
[Hooray for awful plot twists, I kinda didn't know what to do with Id anymore so now he was just Corset in disguise. I feel terribly lazy.]
-
[Wasn't he killed?]
-
[No, he just slinked back to the shadowy place, its Corset, he's like Sigma, coming back even after being killed.]
-
[He did in the final episode anyway, so why the [tornado fang] not? Also, how's everything holding up so far? I'm gonna play some tricks on the racers with the terrain in 3..2..1.]
The terrain suddenly started shaking, as if there was another creature sharing the territory with it's kin. A creature emerges from the ground after the odd events have passed, with another possibility of two conflicting hells, one from the angel's dimension and the mostly-unknown hell who's gateway is in an abandoned factory. In such cases, holy figures from around the world have gathered at Rainbow Park, which rests right next to the Rainbow Road speedway.
???: Fellow gods, I have sensed that we have been intruded by an evil force far beyond the reaches of our dimension.
*other gods murmur amongst the shocking details*
-
[Hmm, still wondering what I'm going to do with the Anarchy sisters, Stocking is storming off presumably to either take care of that CreamPuff Truck or to sleep, still not sure what I want to do with Panty. Garter, Chuck, and the rest of etc. that I stockpiled kinda just get to sit. I'll post again in a bit, just waiting for more development before I get started.]
-
[Have them return home and never come back >.>]
-
[Hey, don't tell me how to operate my characters. :( for now lets just say the misc people that were stockpiled in the bleachers have left. I still have more plans for the PSG characters.]
-
[Ugh..I still don't get why you don't come up with your own characters >.>]
-
[I do have one character, RMZX, and he is a complete mary sue, I can't write in limits and I really can't keep things straight. With pre-established characters I at least have some grounding and limits. I'm not exactly the best character writer, or even marginally good. I can't exactly help it, and I enjoy RP'ing, but this is getting pretty bad for me. I'll consider when this arc gets near its end whether or not to continue.]
-
[Sigh, that's a rather bad reasoning you got there. You know what a Mary Sue is? Then make sure your character isn't one! BTW Gaia...what Rainbow road? there is no rainbow road in the race as far as I know...You know what? Until some more people join this RP I'm not going to post here]
-
[Y'know I tried making him not a mary sue.
Didn't work so well, at least its going in the right direction.
and enjoy your Rp vacation, Blackhook.
And Gaia, c'mon now, we can't have gods coming from nowhere and residing in a park made of Prismatic Solid Light, its throwing the whole story... well, whats left of it Thank you, [tornado fang]ing dumbass RMZX., out of whack.]
-
(I could have SWORN there was a Rainbow Road in the RPM map topic, inbetween the pokemon leauge in space and the wily star remains.. hm. o~O)
-
[there is... but from what it looks like this RP is dead, thanks a lot RMZX Idiot.]
-
[Also Gaia..there is enough [parasitic bomb] going on..so please try going with the flow for once ok?]
Posted on: May 12, 2011, 09:35:09 PM
[RMZX..get a hold of yourself! Things aren't revolving around you so you are not the cause of this RPs inactivity! Man up for once!]
-
[egh, i'll try. but for now i'm going to be out of commission, no real reason to post new stuff when there isn't anything going on.]
-
(( hows about we all chill the hell out. The fault here likes with the type of RP you all trie to make. A race. Which was probably a very bad idea. It is something which isnt meant to be Role played or written, but visual. Anmd given Rps are designed to go on for a while, Its the reason I decided to withdraw from the race before it started. I realized I wasnt going to be able to keep it up.))
-
[I don't believe it was the fact that the arc was based on a race, rather that I tried to make it too damn long (9 tracks in an RP thread which is usually known for having short but sweet arcs. What the hell was I thinking that time). Of course the fact that I tried to make this like a game was another big in itself mistake, not to mention making a very mysterious and potentially god awakening/world destructive weapon harboring place as the Ruined God Killing Complex as the second track was yet another horrible, horrible mistake.
Really, the racing arc would have worked out just fine if it were kept short (3-4 tracks about 10 post long), simple (DA RUUUULEZ!!), and I had not tried to make a conspiracy story out of it. But yeah, no one in here is to blame. As much fun as I had conducting this arc, I feel it is time to have a change of scenery. At the very least, this gives me some experience as to what to do, and not do while in charge of an arc's events, story and so forth.
So with that said, I think it's time to move on to the next arc, wouldn't you folks agree? Now the real question would be; how to properly end this arc short without the need to retcon it completely?]
Posted on: May 13, 2011, 12:17:30 PM
[So Blackhook and I came up with a way to move on to the next arc while keeping things coherent with the recent events in the "plot". So without further ado...]
Many racers had finally made it to the finish line. In first place were the spandex wearing wonders, The Spark 6, who held in their hands the 3 flags and bountiful token needed to gain an immense amount of points in this challenge. A few racers were still left inside the chaotic ruins but it seemed like most of the masses didn't mind. The lakitu carrying a monitor made it's way to congratulate the winner of this track.
"Well done, well done! Kyo HO HO HO! That was quite the cunning performance you've given us there, Spark 6. And seeing as you've gotten your hands on both the flags and token, AND have finished in first place. That gives you a whopping number of 1000 points! Taking Sparvania in the lead of this race!"
The sparvanian crowd cheered, as the citizens of RPM booed and shouted at the animal based individuals and the race's host.
"Now then, if you don't mind, I'll be happy to take that token of your hands...you can keep the flags as a souvenir." An appendage sprouted from the side of the monitor and reached out to grab the token with it's gloved hand. Right before he could get a hold of the glowing object, Silan's image had popped up at the stadium's gigantic screen.
"What's this then?" Mr. Hatter questioned.
-
"I have to appologize for my interuption but hereby I have to interupt this race for a moment."
Said the leader and looked at Mr. Hatter.
"Mr. Hatter, I would like you and Hawk of the Spark 6 to come to my private chamber, now!"
She ordered them. This started a confusion within the crowd. What was going on?
-
"Grrr. What's this brat want?" Mr.Hatter grumbled to himself.
Hawk had left his team and drove away to the grand airship of sparkvania. Meanwhile in the host's tent.
"The race is doing so well and Mrs. I'm-so-much-better-and-powerful-than-you-because-I'm-an-empress-of-an-entire-country-type-of-dame here wants to interrupt the fun. I tell you if I were her dad, I'd show her to stay in her place during buisness hours! The nerve of some kids this days." He mumbled as he was preparing to get out from his tent and board the ship.
Moments later, both the ranger and top hatted man had arrived on Silan's control room.
"To what do I owe this unpleas-fanciful visit my bratty princess...bratty as in like the doll that is! You like dolls, right oh Princess of mean?" He smiled nervously.
-
"Welcome, ah Hawk, would you kindly hand over that object to me?"
The ranger with the helemt resembling his namesake came over to the empress of Sparkvenia and handed over the tokken.
"Good job, with this your team has proved to be quite useful, tell your comrades my regards."
"We live to help my highness"
Hawk bowed down and left, leaving just Hatter and Silan alone in the now sealed off room.
"I should probably tell you that I grew tired of your habbit of stating things out loud. Also I've never knew my parents so I don't know how to behave during bussiness hours."
She said with a slight hint of irony in her voice. She looked at the tokken in her hand.
"Mr. Hatter, this sharade has gone on fortoo long and personally, I grew tired of it. I am not a fan of races, so I didn't have the patience to let this go on for much longer...now tell me, what are the true meaning of the tokkens. Please be honest and you might enjoy your life for longer."
-
[Oh hey! Nice way to kill the racing.]
RMZX was released from his bindings, he was confused as to where he was, but the landing wasn't pleasant, as he fell face first into concrete. Corset looked over him as he struggled to breathe.
Tsk, Tsk. For somebody as powerful as you claim to be, you lose your breath and you're nothing but a weakling. Pathetic.
You're.... you're letting... me live?
Come now, I might be sparing your life for now, but I'm not going to let you just leave. No, you'll be stuck in this cell, slowly rotting away. I feel its more... Humane. Kekeke.
You're disgusting! Stocking and Panty will come, they'll save me and wreck your plans again.
Don't be so nieve, boy. Look closely at this screen.
Corset showed a monitor to RMZX showing the Two, Stocking storming off and Panty sitting in See-Through, being frustrated and keeping an eye out for any men.
Do you see? Those two could care less about you, you thought Stocking actually liked you? Thats Rich! Panty only stuck around because she was dragged along. Now be a good boy and ROT.
RMZX looked outside, he was unsure where he even was. He couldn't possibly do anything, his weapons destroyed, his stomach panging, he was an empty shell, slowly withering away.
-
"...So huh...how'd you hear that comment?" Hatter asked nervously.
"You know I meant Mrs. I'm-so-much-better-and-powerful-than-you-because-I'm-the-empress-of-an-entire-country-type-of-dame in a good way, right? Along with those other insult sounding praises I said behind your back. right?" He tugged his collar.
"As for the tokens, I-he he. Not quite sure what you're talking about..."
---------------------------------------------------------------------------------------
Meanwhile, at an unknown office.
"Seems that our host has run into a bit of trouble. Such is expected for one who only scored a 1 out of 10 smileys in my "likeable characters chart"." Mr. Dreaderick told his coworkers.
"So, shall we help the poor idiot? *sniff*" Asked Mr. Sickleton
"I'M WATCHING MY SOAPS! O:< " Mr. Marsesko angrily shouted as he watched old reruns of Roa Knows Best.
"He'll be fine, his a...chatty man. He'll keep her busy. Any one up for a small three ton order of Sandvich Duke?" Mr.Hungrenski offered.
"Aye." They all shouted.
"In any case, we should have a change in plans. Call our Research, Star Finders and Costume/Makeover wings to start sending in some of our men to the other locations."
-
"Information is power Mr. Hatter...also I didn't need to hear that comment again...I have my ways of getting informations. That is also the reason I know about your bosses. Also Hawk did a very quick research of this tokken and confirmed that it's not just some regular throwaway item. It is quite old and it contains a dark secret, ain't I right?"
Silan stepped dow from her throne and walked towards Hatter.
"Don't change the subject again please, just give me a straight answer..or else.
Suddenly one of Silan's Blade like wings stabbed trough Hatters arm.
----------------
[Do you mind RMzX if I interfere with your story a little? After all, interaction is a big part of RP :P]
"How come you are always like this? So dependable, so weak?"
RMZX heard a voice..it was a familiar female voice. The voice came from his own shadow.
"Tell me..how many pep talks do you need to finnaly become a man?"
-
[Yeah, sure. It'll help keep my story relevant]
RMZX looked around, he heard a voice and didn't see anybody nearby.
That voice... nah, it couldn't be.
-
"GAAAAAHAAAAAAA!! A, a bit rough don't ya think highness?" He chuckled nervously.
"To tell you the truth, I'm not quite sure what the Big Four what with the tokens. I'm just in it for the big money, is all."
-
"Really? How sad, then you are of no use to me? Well then, I wanted to lock you up with the ladies we apparently captured just recently...but I guess someone like you, I should probably sent you to the shadow realm...and by that I mean kill you"
She said all of this without a slight hint of emotion...what a scary kid she was.
--------
"Yes,I am your coicidence...I mean collision..drat I wanted to say that I am your conscience!"
Said the voice from inside the shadow.
-------
The android girl started poking Afro's head.
-
RMZX was confused.
Why is my conscience a girl... and since when did I have a conscience... Man I must really be out of it.
RMZX Sat up, his body still trying to recover from the tight bonds.
Ok, so spill it, what do you want?
Posted on: May 13, 2011, 04:45:16 PM
Noticing that the voice had either died or gone to sleep conveniently after asking his question. RMZX looked around and found a small ball. He proceeded to throw said ball against a wall. Corset then came down and took said ball, he then threw the ball outside and then walked off.
RMZX was saddened by the loss of the ball.
-
[Patient are we?]
"Well aren't you bored...is that bondage freak gone?"
The voice asked again and suddenly from RMZX's shadow emrged a person - a slim, pretty young girl probably age 18 with straight long white hair, normal complexion, purple eyes. The girl was wearing a simple outfit with a hint of gothic style and she was carrying a short sword. It was Temnota.
"...What are you still doing here? I thought that someone like you would already have a plan to escape? As you conscience I am dissapointed.."
-
[I needed to humor myself, so I made a short.]
RMZX looked at the figure... he blinked many times in disbelief, then stood up in shock.
YOU?! What do you want with me?
-
"Eeeeeh?"
The girl was taken back by RMZX's question.
"W-what? Why are you so unfriendly? It's not like I ever hurt you or anything! I even went looking for you so I could tell you that you were still in the race!"
Said Temnota with teary eyes.
-
Well, for starters, you took my friend, shoved her into your shadow, pushed me into a teleporter when I came looking for her, which threw me into a depressive state where I had people talking to me while i sat on a metal chair in an empty room inside my head because I had given up. That was painful! :(
Anywho, about a plan to break out of here. I had an idea but I have no way of executing it since I don't have my gear. RMZX said rather bluntly.
-
"Oh right..that..I didn't think you were THAT much of a wuss. Also you kinda deserved it for leaving your wife"
She acted nonchalant about RMZX accustations.
"Oh right, you need some weird toys to actually do anything...well can't you build anything new?"
She asked inocently.
-
I don't know what you're talking about... I was never married. Said RMZX, denying the past.
Look around you, this cell is completely empty. And I only use that stuff since I'm not the muscular type. The only thing I really need is that Katana I had, it has sentimental value, plus the blade is pretty damn sharp. RMZX said while looking around for a weakness in the structure of the cell.
-
"Don't deny it...I was there and my friends were there too and it was fun and there was cake. Silan has met with Blackmore which later let her to send Schimmer after him so he could collect some of his magic which led to the creation of the Homunculi that ae working for Sil now. Also I think it was at the wedding that Sil introduced Roa to Father who then granted Roa his newest powers which then led to Roa taking over Sparkvenia after whose disappearance Sil took over Sparkvenia herself..."
Temnota reminded RMZX of past events that were suprisingly tied with his wedding.
"Oh and about a sword..does this strike your fancy?"
Temnota presented RMZX her short katana.
-
Sure, a wedding did happen, but the marriage ceased shortly thereafter... due to my utter disgust at myself. RMZX said, with a hint of regret.
That sword will do quite nicely. Stand back, I'm going to slice these bars.
RMZX held the sword, he swiped at the bars 4 times and created an exit... and a loud clang.
We have to leave now, if we dawdle we'll be caught. There should be a vault someplace, I'm betting thats where my stuff is.
RMZX grabbed Tenmota's hand and ran out of the cage, looking for a stairwell.
-
"That was pretty good for not being the muscular type."
Said Temnota with a slight hint of sarcasm before being grabbed my RMZX, to which she slightly blushed.
"You have any idea where we're going?"
-
We have to find a stairwell, from what I could see from the small jail window we're quite a few stories up. If we want to get to the vault we'll have to go down.
RMZX looked to his right, there was a door. He walked through it. Sure enough there was a stairwell, RMZX proceeded downwards, after a while he was at the ground floor.
We're just about there, lets try and find a map.
MEANWHILE:
Where the hell is Stocking? Getting those damn creampuffs couldn't have taken THIS long!
Panty pulled out her cellphone and called Stocking.
What do you want?
Where are you?
Buying a snack.
Don't we have something we should be doing?
RMZX can take care of himself.
Are you [tornado fang]ing Kidding me? The kid is like a damn twig, he gets disheartened once and he SNAPS! You should know this since you two are tighter than that bondage freak's straps.
Eh. From what you're saying it makes it sound like you're the one who cares about him.
ANGELS!
Garterbelt popped out from the backseat.
HOLY [parasitic bomb] AFROPRIEST! Don't pop out from behind like that!
I don't want to hear it, you two just got a wonderful order.
Oh really, whats that?
UNTIL YOU TWO SOLVE THE CURRENT ISSUE HERE YOU ARE FORBIDDEN TO RETURN TO DATEN CITY! SO GET TO IT!
WHAT? There's no men here, it smells like feet, and apocalypes happen way too often! Its more unsafe than Alleyway sex!
Eh.
Of course you would say "Eh", Your only chance at being with somebody that I won't take from you is in that weak RMZX brat.
YOU KNOW WHAT JUST SHUT UP! I'M SICK AND TIRED OF YOU THINKING YOU'RE SO GREAT WHEN YOU'RE NOTHING BUT AN UGLY WHORE!
HOW DARE YOU CALL ME A WHORE YOU SWEETS GLUTTON!
Typical response.
Panty regained her composure.
Whats wrong with you lately? You've been... bitchier than usual.
I don't want to hear what you have to say about RMZX. Or rather, I don't want to hear a single thing you say, ever again.
Stocking hung up.
Garter, help us out, will ya?
I'm not here to fix your quarrels. Nor am I here to take sides.
Garterbelt then hopped out of the car and walked off.
[What a fun post to fix, I merely intended on Double posting but the second post went into pg. 36 so I had to completely add a new one merging the two old posts into one. So uh, enjoy. I have big things planned for the future and hopefully my outline I have in my head doesn't get deteriorated.]
-
The wall cracked completely and fall to pieces, revealing a secret room behind it. The room looked like some sort of laboratory, though not like any run of the mill lab. It looked like something from ancient days. In the middle of the room was a stone capsule which opened the moment Afro set foot into the room.
From inside it emerged a female humanoid pale android,in silver armor pieces with strange emblems on it. The android looked pretty for human standarts, round head with purple dreadlocks with the face and body of a young woman.
The android opened its eyes. After blinking a few times it looked around and after noticing Afro, walked slowly over to him. It stopped in front of him and kept looking into his eyes.
Afro simply blinked in confusion as the android approached him. "...?" o3o
The android girl started poking Afro's head.
Afro blinked, having spaced out for a moment,"Yo?" he replied, looking up a little at the girl android before him.
(Basically, Afro has unleashed a doomsday device so, I guess that may spark your interest? Also there is a conspiration going on in the race oh and Sparkvenia is trying to take over RPM? Oh and there is also Afro's 'alternate dimension threat' plot)
(Surprised some one still remembered that plot. It was just a way to try and bridge Busy and Busier, but if you guys are interested in continuing it...~)
-
"Oh so you can talk? I'm so glad so glad! It is unknown how long I have been offline so thanks thanks :D "
The android girl was surprisingly cheerful.
"This unit's nameis Bellona...though it appears my main body has been damaged over the years, oh well not so bad, as long as my brain is working I can repair the main body Enyo."
Continued the girl, wandering around the room, still talking in that cheerful tone.
"Say who are you unit? I'd like to know, I'd like to know who I have to thank for starting me up!"
----
"Map? You really think there is a map of this place?"
Asked Temnota while still being pulled by RMZX.
-
We're on the ground floor, this appears to be a lobby of some sort, naturally if we find something like an information desk or something of the sort there should be a map.
RMZX looked around, he spotted an intresting object.
Whats this? Ah, perfect, an infodesk. Its even got a computer... perfect, its still running! Lets try and find out where we are... and where to find my stuff...
RMZX typed some stuff onto the computer, technobabble kinda stuff.
Alright, it says the Vault is located on floor B2, in order to access it we just need to open it up.
Vault...Access...Code...
Whats this? The vault is open already... This could be a trap. You stay here, if it is indeed a trap you can reopen the vault from out here, I'd say be careful but I know you can take on anything. I'll be back in a bit.
RMZX took the stairwell down to floor B2.
-
Afor blinks and smiles back,"Um...yeah. dont mention it."
He followed her a bit, curious really.
"Cool, my names Afro-Shroom." he replied as he looked around the lab,"So...what is this place?" he asked.
-
"Wow, he trusts me that much? I am generally touched."
Temnota then glanced at the computers.
"I wonder if they have any games :3 "
----
Bellona checked some informations and then replied in a cheerful tone to Afro.
"This is me, you are currently inside me. :)"
-
Afro blinked and blushed a little,"Wait what?"
He looked around and figured what she meant but still...something like that doesnt sound right.
-
Down in the streets of nighttime RPM was a single person, a lone hobo searching through the trash looking for a meal to eat - It was Archer.
Once he had gone by the alias of 'Roa' and had been an all-powerful vampire that had almost reduced the world of RPM to nothing, but he no longer had such powers because of the events that had taken place at the climax of the final battle between Roa, Flame and Eatman.
Pulling a half-eaten apple out of the trash, he thrust the thing in his mouth and began to eat what little apple remained while glaring angrily around him. He was angry, frustrated, poor, humiliated, powerless and bored.
Yes, bored. For the man who had once had the world at his fingertips, the life of the average homeless man was quite ... unexciting.
Perhaps I should go look for something to do? He thought after finishing off the apple and throwing the core into some random person's yard, it's not as if I have anything better to do.
-
(aaaaawwww yeah, he's back ladies and gents.)
-
All the racers that still remained in the ruins were teleported safely to the finishing line...except one.
----
Meanwhile at the stadium. Silan, the leader of Sparkvenia appeared once again on the large monitor.
"Dear viewers, I am saddened to tell you that the Great race of RPM, where the prize was RPM itself has been cncelled. The organizator Mr. Hatter never had the intention nor the powers to grand such a prize...I am most sincerely sorry to all participant, especially those who got hurt in the process. I'll assure you that Sparkvenia will handle or medical requests. I am most sincerely sorry for this.."
This message caused a rather big uproar in the audience aswell as with the racers....
----
"You really can't make public speeches"
Commented Adante who was now onboard the Edeleisen.
"Grrrr...I don't enjoy those kind of things...He will pay for making me do that...I wonder how long he'll survive in prison..."
Mr. Hatter was chained up in a cell inside the Edeleisen.
The flying ship then headed towards Sparkvenia.
"Where is Temnota?...Sieg was teleported back..but not her? I wonder..."
-----
"Afro-shroom, why did your face turn red? Turning red is a sign of high fever...or is that a 'blush'?"
Bellona came closer to him.
"Yes, that is a blush...blushing is a sign of embarrasment...are you embarrased about something Afro-Shroom?"
Bellona's eyes blinked.
"Oh...looks like Bellona is more damaged than this unit thought...89% damage...Oh well, this unit will eventually repair herself, this unit is patient. In the meanwhile, Afro-Shroom, you will give this unit some imput? Bellona doesn't even know when she went offline. Please 'fill me in' "
Bellona said with puppy eyes.
----
Meanwhile..wherever RMZX and Temnota were.
Temnota was messing around with the computers.
"Man..Solitaire is boring..oh what's this? Mines? Well I guess it could be fun, although I never understood how it works."
She clicked at the icon she thought were the game but instead a message showed up.
" Self destruct system activated. Starting countdown...5:00 minutes. 4:59,4:58,4:57..."
Temnota looked dumbstruck at the screen.
"Oh..I guess that boy wouldn't like if I blew up this place like that..let's see I should cancel the countdown somehow."
After some typing and clicks the monitor showed this message:
"Countdown cancelled"
Temnote breathed in reliev when:
"Selfdestruct immediately"
"...nyoron?"
The building then exploded..unknown what happened to anyone inside...
And so went by another Busy day in RPM....what is going to happen next?
-
[Before the Explosion]
RMZX opened the door to the vault, it was rather unimpressive, being a large room that was brightly lit, nothing more.
He looked around the room, scanning for his stuff.
Ok... Where is my gear... Aha!
His gear was sitting in a corner, the Katana sitting on top like a trophy.
RMZX recollected the Katana, the rest of the stuff was beyond repair and couldn't be used.
Suddenly, the door behind him shut.
!?
Ufufu, you really think I would let you get your weapons that easily?
Actually yes, I did.
You underestimate me, boy. Now die like a good person.
SELF DESTRUCT IN: 5:00.
[parasitic bomb]!
That won't stop me, I'll just kill you, then take care of your friend upstairs.
COUNTDOWN CANCELLED.
Phew...
SELF DESTRUCT ACTIVATE.
HUH?
The entire facility went up in flames. RMZX was flung out of the building, Corset was nowhere to be found.
LATER.....
Snowy Tundra... a vast empty wasteland... few people attempt to cross it, or rather, few people who attempt to cross it survive.
RMZX crashes into the blanket of snow that makes up this dreadful climate.
Ughh... so... cold.
RMZX struggles to get up.
CORSET!... Huh?
RMZX looked around him... he couldn't see anything but snow.
Where am I?
He sheathed himself in his tattered cloak, it wasn't much protection against the cold but it helped against the wind.
Tenmota? You Here?
He slowly walked foward, if he was lucky maybe he could find a shelter or someplace to get some warmer clothing.
-
"Afro-shroom, why did your face turn red? Turning red is a sign of high fever...or is that a 'blush'?"
Bellona came closer to him.
"Yes, that is a blush...blushing is a sign of embarrasment...are you embarrased about something Afro-Shroom?"
Bellona's eyes blinked.
"Oh...looks like Bellona is more damaged than this unit thought...89% damage...Oh well, this unit will eventually repair herself, this unit is patient. In the meanwhile, Afro-Shroom, you will give this unit some imput? Bellona doesn't even know when she went offline. Please 'fill me in' "
Bellona said with puppy eyes.
Afro gahed, damn those puppy eyes!
"Sure...um, what was the last thing or year you could recall?" he asked not sure where to really start.
-
A shadowy figure appeared in front of Roa..
????: I know many things, and I've been watching everything play out in the shadows. I can help restore you to full capacity.. hehehehe..
-
[You seriously aren't going to do that, are you? You should try and focus on where the hell Gaia is, since nobody's heard from him in like... 3 pages.]
RMZX looked around the barren tundra. Its been a few hours now, the wind petrifying his face, he attempts to make a small shelter against the wind... no luck since he didn't manage to grab anything he might need for winter type weather.
I wonder... if anybody will find me?... probably not... I don't have anything to start a fire with... I might as well face the facts, I'm going to die here.
RMZX huddled up into a fetal pose trying his best to stay warm. He slowly fell asleep.
-
[I think I'll just ignore that.]
Archer's explorations for something to do had been cut short by the sound of a huge explosion. Deciding it would be in his best interests to turn tail and head in the opposite direction, he did so which eventually led him into the snowy tundra.
Luckily for him, the large amount of rags he wore to pass as clothes not only hid his identity from those who had known him previously, but were also quite warm.
Well, he thought bitterly as he made his way across the barren land, this was a wonderful idea.
Too caught up in his thoughts, Archer never noticed the person in fetal position of the ground and nearly tripped over them.
"What?" He said in surprised, before taking note of what tripped him, "a person all the way out here?"
-
RMZX stayed in his fetal position, trying his best to retain the scant amount of body heat he had left.
He shivered a small bit, then went quiet.
-
"Hey, you!" Archer shouted as he gave RMZX a good, hard kick. But still he did not stir.
"Fine then. Be that way," he murmured as he crouched down and began to rid RMZX of his possessions - they would be of more use in his hands, no doubt.
-
RMZX tried to get up. Still rather cold.
"Why are you taking my stuff?" questioned RMZX.
-
"Because. I want them." He explained, about to continue before he stopped.
"Don't I... know you from somewhere?" He asked curiously upon recognizing the familiar face.
-
"I don't believe we've met... can't say I recognize you." RMZX replied.
"All I really need is my Katana, that other stuff is trash. If you think you can fix it by all means go ahead." Mentioned RMZX.
RMZX took his Katana back.
"Say, you came from outside of this tundra, right? Do you know a way out?" Asked RMZX.
-
I suppose it would be best if I didn't just reveal my identity - who knows what kind of reaction it would cause. Seems like too much of a hassle to deal with, Archer thought with a sigh.
"Of course I know a way out." He shook his head amused, "I really don't have much business hanging around here anyway, so if you just follow me I can show you the way out...."
-
Suddenly RMZX got punched in the back of his head.
"How, how could you!"
Temnota,who seemed to be covered in snow ,was standing behind RMZX, quite angry, which is unusual for her.
" I get worried about you, thinking that you might have died and what do I see? You're giving away the sword Sil made for me, which I was nice enough to lend you! Not only that you described it as trash! That's unforgivable!"
The girl looked at the Hobo, recognising the short sword in the pile he was holding.
"Mister, would you please give me that sword?"
-
Archer's eyebrows shot up.
I remember this one... He thought, easily recognizing the girl.
"Oh? This?" He asked holding up the sword, "I would give it back to you, but I wonder... what would I obtain in return?"
-
RMZX covered the bruise on his head.
"I was talking about my old weaponry... Not your sword... jeez sorry. I honestly thought I gave it back to you." Apologized RMZX, despite knowing that his apology wasn't going to be accepted.
-
"O-obtain? Whaaaa, you won't just return it to me?"
The girl wanted to use her shadow bind attack, but she was too tired to control shadows.
"Let see..I really don't have anything..only the clothes I wearing..."
----
"My time you ask, Afro-shroom. Well of course I can tell you all about it..."
The android paused for a second, then replied.
"Acces to memory files corrupted...it appears even my memory files got damaged. Now I don't even know what this unit was built for or it's purpose. Maybe if the main body gets repaired, my memory repairs aswell?"
She mused to herself.
-
"Hey I love being on my way to hypothermia, but does anybody have anything to start a fire with? I can barely feel my arms." Stated RMZX, who looked rather blue.
-
"Ah, ah," said Archer ignoring RMZX, "couldn't you just have your, uh, friend... 'Sil' was it? To get me something of equal value?"
-
RMZX, looking rather annoyed, swapped his Katana for Tenmota's sword.
"There, Problem Solved." Said an irritated RMZX.
RMZX gave the sword back and headed off alone.
-
Archer held up the Katana and observed it.
"Cool," he commented, before heading after RMZX.
"I've fininshed conducting business so I'll be heading out here myself, so allow me to show you the way out." He told RMZX before smirking, "thanks for the sword."
-
"Sure, fine." RMZX said rather hastily.
-
"I-I c-can't do that..SIl would punish me if she ever finds out..."
The girl looked around, hoping not to see one of the many Vogel spies SIlan was using to monitor RPM.
"I-I don't wanna dissapoint her..."
Rmzx then did his little swiping and returned the sword to Temnota.
"WHa..Thank..you?"
Before she could thank him properly he headed off.
"H-he's kinda nice af-after all"
The cold caught up with the girl as she then fell to the ground.
-
Archer turned after hearing the sound of Temnota collapsing.
"I think you might want to do something about that," he told RMZX.
-
RMZX backtracked to Tenmota and held her in his arms.
"Would be wrong to just let her die, Lets go." Said RMZX to Archer.
-
"Of course. This way," Archer instructed as he began to walk back the way he came.
-
RMZX followed Archer, Soon enough the three were back in the city.
"Thanks a ton, consider the Katana as payment" Said RMZX as he walked off still holding Tenmota in his arms.
"Lets find you a place to rest" RMZX said to himself.
He walked until he reached a park, it was a quiet place, not many people around. RMZX lay Tenmota under a tree and walked off.
"Not much point in staying around here, I'm just going to go find a place to relax." Said RMZX, noticably exhausted.
-
"My time you ask, Afro-shroom. Well of course I can tell you all about it..."
The android paused for a second, then replied.
"Acces to memory files corrupted...it appears even my memory files got damaged. Now I don't even know what this unit was built for or it's purpose. Maybe if the main body gets repaired, my memory repairs aswell?"
She mused to herself.
Afro hhrmed,"Well thats a problem." He looked around and observed the aged and in need of repair 'body' he was walking inside of,"Well If theres any way I can help Id be glad to do so." he said looking back at the android.
-
[So just to be sure, was the building where RMZX held also the same prison for Mr.Hatter, or is he being held in the Eidesolingkaplaba-airship?]
The news of the race and Mr.Hatter impossible offerings brought out spite from the racers and spectators. The locals still worried and wondered of the whereabouts of their leaders. This seemed like a good time for Sparkvania to usurp the country, but it seems their empress has no plans in doing so. So the people of the red barren lands waited to see what orders their strong and vicious leader would give. Of course there were some subjects who were a nit impatient...
"Hmph, to think I've left my abode to gain nothing at all for our dear Sparkvania" The man in the owl carved coffin spoke.
"Didn't even get my feel for adventure from this race. Twas a disappointing little event, if I may be so bold say."
"Nonesense, comrade. It was a good change of pace, I enjoyed my time in this race. But like you I too wished it was a bit more exciting." Responded the homeless racer, drinking a beverage from the nearby food stands.
"May I ask why a commoner such as yourself is speaking to me so formally?"
"Are we not from the same land? Despite the large gap in our social status, we still want what is best for our country, no?" The man continued to gulp down his beverage as he used his free hand to grab some unattended snacks to stuff in his mouth.
The owl man looked at the hobo with a bit of disgust, mostly for his table manners.
"True, but without the race, there is not much for us to do. Seems we must depart to go back to our dull lives in grand lands." He said, with depressed tone in his voice.
"I wouldn't be so quick to give up. There IS a reason for this sudden turn of events, my coffin loving friend." He told the man, before taking a big gulp.
"...Are you perhaps referring to the true purpose of this race?"
"Of course. There must be good reason why our empress had put a stop in this race."
"Perhaps that reason was something that could truly give us sparkvanians the power to rule over this mechanized utopia they call RPM..." The owl man was intrigued.
"Of course, this is all speculation..." The vagabond continued to devour the meal laid in front of him.
Hermescus of the Athena House curiosity was picked, he wished to find out a bit more about the circumstances responsible for the abrupt halt for the race. He slowly closed down his coffin to lay to rest, but before he had closed the lid completely, a small figure jolted out from the coffin.
------------------------------------------------------
Meanwhile, in the tent sections of the stadium, a masked man was investigating the area thoroughly.
-
[That building had nothing to do with my characters...Hatter is now in a Sparkvenian prison...]
Meanwhile in Sparkvenia! *Lord Zedd theme*
Silan and her closets confidants assembled around a roun table. IN the middle of it were the two tokkens found in the race and taken from Hatter.
"So..what's the deal with the shiny balls?...Do they belong to a dragon?"
Asked Adante the musician.
"I...wait, isn't someone missing?"
Wondered Sieg.
"I wonder...is she hiding in someone's shadow?"
Asked Stolz and everyone around the table looked at their shadows.
"Temnota....!"
Silan seemed worried.
----
Temnota gathered up some strength. She looked around and noticed RMZX wandering off.
"..idiot..hypothermia won't just disappear...."
----
-
[Building was some prison in some random place, probably near that tundra.]
"Hm?" Said RMZX, rather confused, he thought he had heard something, so he turned around. He noticed Tenmota waking up.
"You're awake? Hmm, how are you feeling?" He asked politely.
RMZX held out a hand towards Tenmota.
"Here, I'll take you back to Sparkvernia Mechasia, I know you could do it yourself but with that hypothermia you aren't going anywhere by yourself." Said RMZX Kindly.
-
((We really shouldnt be using Sparkvernia. Honestly. It doesnt exist in RPM anymore since Sparky left, and he DOESNT like us using it. if we all rose up to say that he had to take it with him if he left here, then we need to not be hypocrites and stick by that word))
-
[But we've all been using it since the dawn of time. What do you suggest we do, change the name in the middle of the RP for no definable reason?]
-
((Yes. why not? Sparkvernia doesn't exist. Deal with it. create a NEW, ORIGINAL place. we have the entire badlands open for a new evil overlord. its not like Sparky and Sparkvernia ever participated THAT much. you could change the name and noone would be the wiser. I'm Just tired of keeping on seeing Sparkvernia used when we all were the ones who said He had to take it with him and it had to be removed from the map because he left.))
-
"Ok, I need to look for Temnota so we have to make this quick."
Said Silan to her council.
"Since there have been many changes in this country since I have taken over and alsoAfter that debacle with the race noone would take the old name seriously so I've been thinking that it would be the best to rename it. So..who is for Silasia?"
Everyone around the table was quiet.
"Critics...ok then how about Mechasia, the country of machines?"
This name was better..though it still didn't sound as nice as Sparkvenia. The council members raised their hands in agreement.
"Ok release the message, this land is from today on known as Mechasia. Remove all mentions of the name Sparkvenia from the archives, also remove the name of it's founder and also the name of his succesor Roa. The only leader of this land was and is me, Silan Eisenholz, the zivel of gold. Any objections, no? Good, now let's move on..."
-
[Alrighty, problem solved.]
-
(I say we try to do that Alternate RPM thing that never got off the ground.)
-
[I thought that this was the alternate RPM? If not, then sure.]
-
(I say we try to do that Alternate RPM thing that never got off the ground.)
( *o* )
-
I wanted to go with it from day one, but it never happened. then Busy world closed.
-
(rwhat alternate RPM thing?)
-
(The one we are going to do right now...because Mr. Afro finnaly has time, right?)
-
Lets finish up the RPMvania first though.
-
Hate to sound like a prick, but since you guys are all up in arms about RPMVania's ending, why not work on this during the hiatus? Seems like a better plan than arguing about skipping the final fight or not.
I mean, we could just cram a small story-arc in while you guys try to decide your plan for the ending so that way Afro can have a chance to participate in the Alternate RPM arc which by the looks of it he was really looking foward to.
Just an Idea.
-
works for me.
as long as people actually post here too.
-
I'll post, thats for sure.
-
I'm up for that suggestion. Just hope the rest of the gang will follow.
-
From what I can tell its recently been just:
Me (Obviously)
Flame
Blackhook
ST
Afro
White-Jet
Gaia
Archer
Shouldn't be that hard for 8 people to follow suit. It'd be kinda nice if we had more people (Variety and whatnot.) But 8 is workable.
Posted on: July 13, 2011, 06:59:43 PM
*Sigh* nobody has posted yet, probably because the story is at somewhat of a standstill at the moment.
I'd gladly post but I can't really go anywhere from my previous story post without Blackhook. :\
-
This RP has become such a mess. I'd say we burn down this place, grab the insurance money and build a new one.
-
This RP has become such a mess. I'd say we burn down this place, grab the insurance money and build a new one.
THAT'S WHAT I SUGGESTED WHEN THE FIRST ONE DIED.
AND YOU ALL IGNORED ME.
-
This RP has become such a mess. I'd say we burn down this place, grab the insurance money and build a new one.
*resists the urge to quote Flame Hyenard*
-
A mess of normal talk or a mess of plotholes and general confusion?
I can understand that, probably a decent amount is my fault.
-
All of the above? o~O
-
So, what do we do from here? Can the whole RP? Start on Alternate RPM as planned? Anything that isn't just random banter about what do do?
-
Somethin'.. a little chaotic, but not as chaotic as this plot. Panic el Resturante perhaps?
-
Well we could simply transist this to the alt rpm arc from before, seeing as it was simply put on hiatus and there would still be rampant alternate versions of RPMcitizens running about. Alt Afro, Alt. SIlan and the elusive agent J are still present in the main RPM world while Dan was still stuck A. RPM.
-
I like what afro is thinking.
I vote for his idea.
-
I like what afro is thinking.
I vote for his idea.
owob
-
Really would have been nice to have Roa in on the Alt RPM arc as a good version from the alternate world. :\
-
Its not like we can't do that since Archer is unbanned.
Question is if he would be willing to do it or not.
-
I believe we may have typecast him as villain. i mean, he just does it so well...
-
True, sometimes it feels as if Archer always gets stuck with that role. '>.>
But anywho things should be clearing up and becoming more stable now so Im free to start up this ALt. RPM arc. *o*
-
...Give it up.
-
If we can get something started than we should at all means try to get something going.
Posted on: August 22, 2011, 02:51:02 PM
No point in waiting since most of the cast is missing/quit and half of us don't post regularly.
I'd be glad to start but since blackhook is pretty much calling it quits I have no way to continue unless the last three pages or so of my posts are entirely retconned. And I'm kinda sick of retconning.
-
Sigh....looks like this hope is deader then Yhamcha from DBZA. ;O;
-
we should just start another rp again, instead of starting off from where this ended maybe we could just reboot the storyline.
Before that of course we should wrap what we can up instead of leaving this on an imcomplete note.
-
How about we wrap up the RPMVania RP? thats been on hiatus for a while, and is already near the end. Thats a horrible place to stop.
-
How about we wrap up the RPMVania RP? thats been on hiatus for a while, and is already near the end. Thats a horrible place to stop.
I thought you guys all agreed to skip the final battle and just go to the ending/epilogue? At least, thats what I gathered from the last page.
-
No, I talked to Afro and he was fully willing to finish the final battle.
-
I really cant bring myself to just skip to the epilogue so far into the end already.
-
Exactly my feelings as well!
-
we can skip to the end of whatever we're doing in this RP, right?
because at the moment there really isn't anything going on.
Posted on: September 02, 2011, 12:27:23 AM
Or, Option B:
Kill everything/everyone, Bad End, start a new RP from step one.
I think what really made this suffer towards the end is that is was an essential continuation of an RP that over half of the original cast wasn't taking any part in, and even further cast reductions were caused by the splitting of the RPMVania story that was going to be in this thread into its own thread. Thus leaving the cast to a paltry 6/7 people at best.
So what we really need is something new that doesn't alienate newcomers like this one did (After all, I don't think we had any newcomers into this RP, whereas we had tons in the original to fill in gaps for people who stopped posting.)
So either we continue what's left of this, or farewell busier world and we start something different.
-
But this is not the right place for such a conversation. A mod should simply lock this thread.
-
Make a new thread. The Even Busier World of RPM
-
But this is not the right place for such a conversation. A mod should simply lock this thread.
But where would we have a conversation otherwise?
Its not like we have a "Continue Busier World or kill it" thread.
Make a new thread. The Even Busier World of RPM
Wouldn't that just make people think its another RP like this one and stay away from it like they did this one?
We should just make a new RP not using the Busy World name, that way it at least looks new.
-
Make a new thread. The Even Busier World of RPM
Super Busy World of RPM Arcade Edition Version 2012
-
Super Busy World of RPM Arcade Edition Version 2012
You forgot the AE HD ReMix part.
-
You forgot the AE HD ReMix part.
I think that killed the gag.
But I digress.
I'm up for a new RP if we decide to go for that.
-
Super Busy World of RPM Arcade Edition Version 2012
*selects his character*
But I digress, If we WERE to make a new RP, dropping the Busy World from the title, would it essentially be the same sandbox style RP we had but have nothing to do with what happened in the Previous RP?
-
*selects his character*
But I digress, If we WERE to make a new RP, dropping the Busy World from the title, would it essentially be the same sandbox style RP we had but have nothing to do with what happened in the Previous RP?
Yeah, thats pretty much what I was going for, dropping Busy World from the title keeps it fresh.
-
Kinda, if we drop the busy world part though we'd need to differentiate it IC from Busy world in some ways as well. things like story mythos and backgrounds and such.
or go SMB2 USA and just name it something else and pretend its a new story. :P
-
Kinda, if we drop the busy world part though we'd need to differentiate it IC from Busy world in some ways as well. things like story mythos and backgrounds and such.
or go SMB2 USA and just name it something else and pretend its a new story. :P
The second option is what I'm going for.
No need to change what is already present, the only thing we need is a new name.
-
SOunds good i suppose. SO what should this be called?
The NOT so hectic universe of RPM? :P
-
Fast times at RPM.
that's my vote.
When this does get done I would like to make the topic if its alright.
-
How about we just name it "RPM" or "RPM city" or some such title. No need for cumbersome needlessly complicated titles.
-
Well, RPM would be too confusing.
RPM City sounds ok.
I'll go ahead and get the topic started then.
-
How about "The Graveyard of RPM", because that's what it'll turn into soon enough after people stop posting.
-
Well, RPM would be too confusing.
Are you shitting me
How about "The Graveyard of RPM", because that's what it'll turn into soon enough after people stop posting.
Lol. got a point there.
-
Are you shitting me
Sarcasm, my boy.
Topic is up.
Another Edit:
I'm apparently a power hungry freak.
No everybody dies ending, no RP ending, do what you wish.
-
Why ending it on a mean spirrited way like that. I know you've got issues but there is no need to unleash it like that on innocent RP characters.
You sir are a Douche
-
I was "away" and thus wrote myself out long before that ending, since I was busy doing other stuff as well. >.>
-
Why ending it on a mean spirrited way like that.
Because every story that starts out ok is bound to end in tragedy. Besides why are you annoyed I ended it like this you wanted this RP to die since I suggested reviving it.
I know you've got issues but there is no need to unleash it like that on innocent RP characters.
Issues, what do you speak of?
You sir are a Douche
Thank you, I'm flattered.
Topic Done.
-
Because its totally not possible to just say "RP over" right? like the last one?
-
Thats not in my jurisdiction.
If one of the mods wants to lock this then they can go ahead and say "RP Over".
-
So its not in your jurisdiction to say "alright folks, this rp is over, lets move to the new one" but it IS in your jurisdiction to just kill off the cast in order to move on.
-
So its not in your jurisdiction to say "alright folks, this rp is over, lets move to the new one" but it IS in your jurisdiction to just kill off the cast in order to move on.
Point taken.
-
Suddenly, I use Future Fusion to send three Blue-Eyes White Mega Mans from my deck to the graveyard to special summon Blue-Eyes Ultimate Mega Man from my deck in two turns' time.
-
As Ladd plotted to summon his fabled monster of lore, a second figure rose from the dust of the dead roleplay realm. His long, black duster flapped in the wind, his vulpine tail flicking between the V-split. In either of his black-brown hands, he clutched something. Something long, something pale brown and covered in small roots...
He spoke quietly, his golden eyes focused on Ladd from behind his glasses. "I come from the shadows to deliver unto you..." Suddenly, he leapt into the air and with an echoing warcry, he threw the objects at the bionic commando!
"Yaaaaams!!!"
-
*Grabs enough yams to upgrade to 7 health units with bionic arm*
-
The fox crossed his arms and gave a grin. "My job here is done. Yams away!" And then he jumped off a cliff and into a spike pit. The landing probably wasn't intentional, but the jump sure looked cool!
-
*Swings into wall, picking up yams as I touch them, then hits wall, bounces off, and lands with gun pointed forward*